SAB1403024

Monoclonal Anti-CRSP3 antibody produced in mouse

clone 4H6, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): CRSP130, CRSP133, CRSP3, DKFZp434H0117, DRIP130, SUR2
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: mouse
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 4H6, monoclonal
• Formulário: buffered aqueous solution
• peso molecular: antigen ~37.11 kDa
• reatividade de espécies: human
• técnica(s): capture ELISA: suitable; indirect ELISA: suitable
• Isotipo: IgG2aκ
• nº de adesão NCBI: NM_004830
• nº de adesão UniProt: Q9ULK4
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... MED23(9439)

Descrição

Descrição geral

The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. This protein also acts as a metastasis suppressor. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene. (provided by RefSeq)

Imunogênio

CRSP3 (NP_004821, 531 a.a. ~ 630 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LTVHAKMSLIHSIATRVIKLAHAKSSVALAPALVETYSRLLVYMEIESLGIKGFISQLLPTVFKSHAWGILHTLLEMFSYRMHHIQPHYRVQLLSHLHTL

forma física

Solution in phosphate buffered saline, pH 7.4

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 1
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable