SAB1400141
Monoclonal Anti-IL15 antibody produced in mouse
clone 3A3, purified immunoglobulin, buffered aqueous solution
Sinônimo(s):
Anti-IL15, Anti-MGC9721
Faça loginpara ver os preços organizacionais e de contrato
About This Item
Produtos recomendados
fonte biológica
mouse
conjugado
unconjugated
forma do anticorpo
purified immunoglobulin
tipo de produto de anticorpo
primary antibodies
clone
3A3, monoclonal
forma
buffered aqueous solution
reatividade de espécies
human
técnica(s)
indirect ELISA: suitable
Isotipo
IgG2aκ
nº de adesão UniProt
Condições de expedição
dry ice
temperatura de armazenamento
−20°C
modificação pós-traducional do alvo
unmodified
Informações sobre genes
human ... IL15(3600)
Descrição geral
The protein encoded by this gene is a cytokine that regulates T and natural killer cell activation and proliferation. This cytokine and interleukine 2 share many biological activities. They are found to bind common hematopoietin receptor subunits, and may compete for the same receptor, and thus negatively regulate each other′s activity. The number of CD8+ memory cells is shown to be controlled by a balance between this cytokine and IL2. This cytokine induces the activation of JAK kinases, as well as the phosphorylation and activation of transcription activators STAT3, STAT5, and STAT6. Studies of the mouse counterpart suggested that this cytokine may increase the expression of apoptosis inhibitor BCL2L1/BCL-x(L), possibly through the transcription activation activity of STAT6, and thus prevent apoptosis. Two alternatively spliced transcript variants of this gene encoding the same protein have been reported. (provided by RefSeq)
Imunogênio
IL15 (NP_000576, 49 a.a. ~ 162 a.a) full length recombinant protein.
Sequence
NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Sequence
NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Ações bioquímicas/fisiológicas
Interleukin-15 (IL-15) stimulates the proliferation of T lymphocytes and shares many biological properties with IL-2. It exerts its biological activities primarily on T cells. It is also essential in the development, survival and activation of NK cells. On binding to its receptor, IL-15 is indirectly involved in activating proto-oncogenes. Increased expression of IL-15 has been implicated with rheumatoid arthritis, inflammatory bowel disease, multiple sclerosis and diseases affiliated with retroviruses like human immunodeficiency virus (HIV) and human T-lymphotropic virus-1 (HTLV-I).
Características e benefícios
Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.
forma física
Solution in phosphate buffered saline, pH 7.4
Exoneração de responsabilidade
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Ferramenta de seleção de produtos.
Código de classe de armazenamento
10 - Combustible liquids
Ponto de fulgor (°F)
Not applicable
Ponto de fulgor (°C)
Not applicable
Certificados de análise (COA)
Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.
Já possui este produto?
Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.
Anjali Mishra et al.
Clinical cancer research : an official journal of the American Association for Cancer Research, 20(8), 2044-2050 (2014-04-17)
Interleukin-15 (IL-15) is a proinflammatory cytokine involved in the development, survival, proliferation, and activation of multiple lymphocyte lineages utilizing a variety of signaling pathways. IL-15 utilizes three distinct receptor chains in at least two different combinations to signal and exert
Huaqin Yuan et al.
Neoplasia (New York, N.Y.), 17(5), 410-420 (2015-05-31)
Intrarenal interleukin-15 (IL-15) plays a major role controlling epithelial survival and polarization both in physiological and pathologic conditions. Herein, we confirmed that human renal cell carcinomas (RCCs) express a membrane-bound IL-15 isoform displaying an unusual molecular weight of 27 kDa.
Patricia K A Mongini et al.
Journal of immunology (Baltimore, Md. : 1950), 195(3), 901-923 (2015-07-03)
Clinical progression of B cell chronic lymphocytic leukemia (B-CLL) reflects the clone's Ag receptor (BCR) and involves stroma-dependent B-CLL growth within lymphoid tissue. Uniformly elevated expression of TLR-9, occasional MYD88 mutations, and BCR specificity for DNA or Ags physically linked
Bieke Broux et al.
Journal of immunology (Baltimore, Md. : 1950), 194(5), 2099-2109 (2015-01-27)
CD4(+)CD28(-) T cells arise through repeated antigenic stimulation and are present in diseased tissues of patients with various autoimmune disorders, including multiple sclerosis (MS). These cells are believed to have cytotoxic properties that contribute to the pathogenic damaging of the
Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.
Entre em contato com a assistência técnica