Pular para o conteúdo
Merck
Todas as fotos(1)

Documentos

SAB2101148

Sigma-Aldrich

Anti-IL15 antibody produced in rabbit

affinity isolated antibody

Sinônimo(s):

Anti-IL-15, Anti-Interleukin 15, Anti-MGC9721

Faça loginpara ver os preços organizacionais e de contrato
Todas as fotos(1)

About This Item

Número MDL:
MFCD01635264
Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

100

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

forma

buffered aqueous solution

peso molecular

13 kDa

reatividade de espécies

dog, horse, bovine, mouse, pig, human, sheep, rat

concentração

0.5 mg - 1 mg/mL

técnica(s)

western blot: suitable

nº de adesão UniProt

P40933

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... IL15(3600)

Descrição geral

Interleukin-15 (IL-15), a cytokine, belongs to the 4α-helix bundle cytokine family. IL-15 gene is located on human chromosome 4q31.2.

Imunogênio

Synthetic peptide directed towards the N terminal region of human IL15

Ações bioquímicas/fisiológicas

Interleukin-15 (IL-15) can activate inflammatory cell recruitment, angiogenesis, and synthesis of other inflammatory cytokines. It plays a key role in the progression, homeostatic proliferation, and activation of natural killer (NK) cells, natural killer T (NKT) cells, and intestinal intraepithelial lymphocytes (IELs). IL-15 plays a crucial role in the homeostatic modulation of the cluster of differentiation 8 (CD8) memory T cells. IL-15 upregulates the expression of telomerase and aids in enhancing the proliferative capacity of NK, NKT-like, and CD8 T Cells. Mutation in the IL-15 gene results in psoriasis vulgaris.

Sequência

Synthetic peptide located within the following region: RISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWV

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Certificados de análise (COA)

Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Fiona Watkinson et al.
Frontiers in immunology, 11, 594620-594620 (2021-02-05)
Interleukin-15 (IL-15) is a cytokine that has been shown to expand CD8 T cell and natural killer (NK) cell populations, and therefore has potential for potentiating adoptive immune cell therapy for cancer. Previously, IL-15 has been shown to induce proliferation
X Tan et al.
Genes and immunity, 7(5), 407-416 (2006-06-23)
Previous studies have identified mRNA three isoforms encoding interleukin-15 (IL-15) that are produced through differential splicing and encode for the same mature IL-15 protein with two different signal peptides. Our analysis of mouse intestinal epithelial cells revealed two new IL-15
Xue-Jun Zhang et al.
The Journal of investigative dermatology, 127(11), 2544-2551 (2007-06-08)
Through a series of linkage analyses in a large Chinese family cohort of psoriasis, we previously identified and confirmed a non-HLA psoriasis linkage locus PSORS9 within a small region at 4q31.2-32.1. Within the critical region of the PSORS9 locus, IL-15

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica