HPA030917

Anti-MX1 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinônimo(s): Anti-IFI-78K, Anti-MxA, Anti-myxovirus (influenza virus) resistance 1, interferon-inducible protein p78 (mouse)
• Código UNSPSC: 12352203
• Número do Atlas de Proteínas Humanas: HPA030917
• NACRES: NA.43

Propriedades

• fonte biológica: rabbit
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• linha de produto: Prestige Antibodies^® Powered by Atlas Antibodies
• forma: buffered aqueous glycerol solution
• reatividade de espécies: human
• validação aprimorada: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• técnica(s): immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:200-1:500
• sequência de imunogênio: IEDIRAEQEREGEKLIRLHFQMEQIVYCQDQVYRGALQKVREKELEEEKKKKSWDFGAFQSSSATDSS
• nº de adesão UniProt: P20591
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... MX1(4599)

Descrição

Descrição geral

MX1 (Myxoma resistance protein 1) gene is mapped to human chromosome 21q22.3. MX1 is very similar to membrane-remodeling fission GTPases, such as dynamin. The protein has a molecular weight of 70kDa, and contains an amino-terminal globular GTPase domain and a carboxy-terminal stalk domain.

Imunogênio

MX dynamin-like GTPase 1

Aplicação

All Prestige Antibodies^®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Anti-MX1 antibody produced in rabbit has been used in western blotting and ELISA.

Ações bioquímicas/fisiológicas

MX1 (Myxoma resistance protein 1) is an interferon-induced dynamin-like GTPase with a broad spectrum antiviral activity. It restricts the replication of many RNA and DNA viruses. At the biochemical level, MX1 proteins bind to intracellular membrane leading to membrane bending and tubulation, also forming dimers and multimeric rings that might interact with the viral structures. MX1 might be associated with pulmonary arterial hypertension pathogenesis, by affecting the BMP (bone morphogenetic proteins)4 and 9 signaling. MX1 serves as an important marker in the diagnosis of dermatomyositis. Genetic variation in MX1 might contribute to systemic lupus erythematosus susceptibility and chronic hepatitis C virus progression.

Características e benefícios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST78815

forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 1
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable