Pular para o conteúdo
Merck
Todas as fotos(7)

Documentos Principais

HPA030782

Sigma-Aldrich

Anti-MKL1 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinônimo(s):

Anti-BSAC, Anti-KIAA1438, Anti-MAL, Anti-MRTF-A, Anti-megakaryoblastic leukemia (translocation) 1

Faça loginpara ver os preços organizacionais e de contrato

Selecione um tamanho

100 μL
R$ 4.140,00

R$ 4.140,00


Check Cart for Availability


Selecione um tamanho

Alterar visualização
100 μL
R$ 4.140,00

About This Item

Código UNSPSC:
12352203
Número do Atlas de Proteínas Humanas:
NACRES:
NA.41

R$ 4.140,00


Check Cart for Availability

fonte biológica

rabbit

Nível de qualidade

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

linha de produto

Prestige Antibodies® Powered by Atlas Antibodies

Formulário

buffered aqueous glycerol solution

reatividade de espécies

human

validação aprimorada

RNAi knockdown
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

técnica(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

sequência de imunogênio

EQEKRAQQPAPAPAPLGTPVKQENSFSSCQLSQQPLGPAHPFNPSLAAPATNHIDPCAVAPGPPSVVVKQEALQPEPEPVPAPQLLLGPQGPSLIKGVAPPTLITDSTGTHLVLTVTNKNADSPG

nº de adesão UniProt

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... MKL1(57591)

Categorias relacionadas

Descrição geral

The gene MKL1 (megakaryoblastic leukemia (translocation) 1) is mapped to human chromosome 22q13.2. It belongs to the myocardin-related family of transcriptional coactivators. The protein is present in the cytoplasm and nucleus. It is widely expressed in human tissues.[1]

Imunogênio

megakaryoblastic leukemia (translocation) 1 recombinant protein epitope signature tag (PrEST)

Aplicação

All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-MKL1 antibody produced in rabbit has been used in immunofluorescence.[2]
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunofluorescence (1 paper)

Ações bioquímicas/fisiológicas

MKL1 (megakaryoblastic leukemia (translocation) 1) is a transcriptional coactivator. G-actin interacts with MKL1 and prevents its association with transcription factor SRF (serum response factor). Release of MKL1 from G-actin results in an interaction between SRF and MKL1. This association controls the expression of cytoskeletal proteins. MKL1 is also involved in skeletal, cardiac and smooth muscle differentiation. It also enhances tumor cell invasion and metastasis.[1]

Características e benefícios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST73615

forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 1

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable


Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Leqian Yu et al.
Stem cell reports, 11(1), 142-156 (2018-07-17)
We show that a human pluripotent stem cell (hPSC) population cultured on a low-adhesion substrate developed two hPSC subtypes with different colony morphologies: flat and domed. Notably, the dome-like cells showed higher active proliferation capacity and increased several pluripotent genes'
Analysis of genomic aberrations associated with the clinicopathological parameters of rectal cancer by array-based comparative genomic hybridization.
Liang JW, et al.
Oncology Reports, 29, 1827-1834 (2013)
Michaela-Rosemarie Hermann et al.
Journal of cell science, 129(7), 1391-1403 (2016-02-14)
Integrin-mediated activation of small GTPases induces the polymerisation of G-actin into various actin structures and the release of the transcriptional co-activator MRTF from G-actin. Here we report that pan-integrin-null fibroblasts seeded on fibronectin and expressing β1- and/or αV-class integrin contained
Adriana Sánchez-Danés et al.
Nature, 562(7727), 434-438 (2018-10-10)
Basal cell carcinoma (BCC) is the most frequent cancer in humans and results from constitutive activation of the Hedgehog pathway1. Several Smoothened inhibitors are used to treat Hedgehog-mediated malignancies, including BCC and medulloblastoma2. Vismodegib, a Smoothened inhibitor, leads to BCC
Stefania Petrini et al.
Aging, 9(5), 1453-1469 (2017-06-01)
Nuclear integrity and mechanical stability of the nuclear envelope (NE) are conferred by the nuclear lamina, a meshwork of intermediate filaments composed of A- and B-type lamins, supporting the inner nuclear membrane and playing a pivotal role in chromatin organization

Questions

Reviews

No rating value

Active Filters

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica