HPA021798

Anti-SIRT5 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab1

• Sinônimo(s): Anti-NAD-dependent deacetylase sirtuin-5, Anti-SIR2-like protein 5
• Número MDL: MFCD07784767
• Código UNSPSC: 12352203
• Número do Atlas de Proteínas Humanas: HPA021798
• NACRES: NA.43

Propriedades

• fonte biológica: rabbit
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• linha de produto: Prestige Antibodies^® Powered by Atlas Antibodies
• Formulário: buffered aqueous glycerol solution
• reatividade de espécies: human
• validação aprimorada: recombinant expression; orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• técnica(s): immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:20-1:50
• sequência de imunogênio: AILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEAL
• nº de adesão UniProt: Q9NXA8
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... SIRT5(23408)

Descrição

Descrição geral

SIRT5 (Sirtuin 5) is a mitochondrial matrix protein belonging to the class III of the sirtuin family. It is localized inside the mitochondria and within the cytosol and nucleus. The protein is widely expressed in the brain, heart, liver and kidney. It is composed of very short amino and carboxyl terminal sequences flanking region with the conserved, catalytic sirtuin center domain.[1]

Imunogênio

NAD-dependent deacetylase sirtuin-5 recombinant protein epitope signature tag (PrEST)

Aplicação

Anti-SIRT5 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting.[1] To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Ações bioquímicas/fisiológicas

SIRT5 (Sirtuin 5) is associated with metabolism and aging process. It has been reported in a study that SIRT5 influences urea cycle pathway by NAD-dependent deacetylation and subsequent activation of carbamoyl phosphate synthetase 1 (CPS1), which plays a vital role in the initial step of urea cycle for the detoxification and removal of ammonia. In non-small cell-lung cancer cells, SIRT5 involvement has been observed for the cancer cell growth and drug resistance. Study shows that SIRT5 may possess oncogenic property.[1]

Características e benefícios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST73830

forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 1
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable