HPA019467
Anti-TAGLN antibody produced in rabbit
affinity isolated antibody, buffered aqueous glycerol solution
Sinônimo(s):
TAGLN Antibody - Anti-TAGLN antibody produced in rabbit, Tagln Antibody, Anti-22 kDa actin-binding protein, Anti-SM22-alpha, Anti-Smooth muscle protein 22-alpha, Anti-Transgelin, Anti-WS3-10
Faça loginpara ver os preços organizacionais e de contrato
Selecione um tamanho
100 μL
R$ 4.140,00
R$ 4.140,00
Check Cart for Availability
Selecione um tamanho
Alterar visualização
100 μL
R$ 4.140,00
About This Item
R$ 4.140,00
Check Cart for Availability
Produtos recomendados
fonte biológica
rabbit
Nível de qualidade
conjugado
unconjugated
forma do anticorpo
affinity isolated antibody
tipo de produto de anticorpo
primary antibodies
clone
polyclonal
Formulário
buffered aqueous glycerol solution
reatividade de espécies
human
validação aprimorada
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
técnica(s)
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500
sequência de imunogênio
EKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQV
nº de adesão UniProt
Condições de expedição
wet ice
temperatura de armazenamento
−20°C
modificação pós-traducional do alvo
unmodified
Informações sobre genes
human ... TAGLN(6876)
Descrição geral
The gene TAGLN (transgelin) is mapped to human chromosome 11q23.2. It belongs to the calponin family. The protein is strongly expressed in the smooth muscle tissues.[1]
Imunogênio
Transgelin recombinant protein epitope signature tag (PrEST)
Aplicação
Anti-TAGLN antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry[2] against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Ações bioquímicas/fisiológicas
TAGLN (transgelin) is an actin stress fiber binding protein. It is mainly involved in cell growth, differentiation, invasion, muscle fiber contractility and matrix remodeling.[1] TAGLN is up-regulated in osteosarcoma cell lines, colorectal adenocarcinoma, prostate , hepatocellular , gastric, pancreatic and colon cancer. However, it is down-regulated in urinary bladder, renal cell carcinoma and colorectal cancer.
Características e benefícios
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Ligação
Corresponding Antigen APREST74706
forma física
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Informações legais
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Exoneração de responsabilidade
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Não está encontrando o produto certo?
Experimente o nosso Ferramenta de seleção de produtos.
Código de classe de armazenamento
10 - Combustible liquids
Classe de risco de água (WGK)
WGK 1
Ponto de fulgor (°F)
Not applicable
Ponto de fulgor (°C)
Not applicable
Escolha uma das versões mais recentes:
Certificados de análise (COA)
Lot/Batch Number
Não está vendo a versão correta?
Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.
Já possui este produto?
Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.
Ben Davidson et al.
Gynecologic oncology, 128(2), 349-355 (2012-11-28)
Endometrial stromal sarcoma (ESS) and leiomyosarcoma (LMS) are the two most common uterine sarcomas, but both are rare tumors. The aim of the present study was to compare the global gene expression patterns of ESS and LMS. Gene expression profiles
Naïma Kaci-Ouchfoun et al.
Asian journal of andrology, 12(3), 422-430 (2010-04-20)
The seminal vesicles of adult sand rat contain a major secretory protein band (MW 21 kDa) designated as Psammomys obesus seminal vesicles protein of 21 kDa (POSVP(21)). This protein is abundant in secretions, regulated by androgens and also present in
Deepthi Rao et al.
Human pathology, 46(6), 876-883 (2015-04-07)
Triple negative (TN) (estrogen receptor [ER], progesterone receptor [PR] and HER2-) are highly aggressive, rapidly growing, hormone-unresponsive tumors diagnosed at later stage that affect younger women with shorter overall survival. Most TN tumors are of the basal type. For the
Mingdong Zhao et al.
International journal of molecular medicine, 34(6), 1565-1572 (2014-10-17)
Alterations in the expression of microRNAs (miRNAs or miRS) have been implicated in the pathogenesis of the majority of human malignancies, and the dysregulation of microRNA-144 (miR-144) has been associated with several diseases. However, the potential involvement of miR-144 in
Gun-Hoo Park et al.
Oncology reports, 32(4), 1347-1354 (2014-08-12)
Neurofibromatosis type 1 (NF1) caused by NF1 gene mutation is a commonly inherited autosomal dominant disorder. Malignant peripheral nerve sheath tumors (MPNSTs), a type of aggressive sarcoma, are a major cause of mortality in NF1 patients. The malignant transformation of benign plexiform
Active Filters
Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.
Entre em contato com a assistência técnica
