HPA018790

Anti-FAIM2 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinônimo(s): Anti-Fas apoptotic inhibitory molecule 2, Anti-Protein lifeguard, Anti-Transmembrane BAX inhibitor motif-containing protein 2
• Código UNSPSC: 12352203
• Número do Atlas de Proteínas Humanas: HPA018790
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• linha de produto: Prestige Antibodies^® Powered by Atlas Antibodies
• forma: buffered aqueous glycerol solution
• reatividade de espécies: human
• validação aprimorada: orthogonal RNAseq; independent; Learn more about Antibody Enhanced Validation
• técnica(s): immunohistochemistry: 1:50- 1:200
• sequência de imunogênio: MTQGKLSVANKAPGTEGQQQVHGEKKEAPAVPSAPPSYEEATSGE
• nº de adesão UniProt: Q9BWQ8
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... FAIM2(23017)

Descrição

Descrição geral

The gene Fas apoptotic inhibitory molecule-2 (FAIM2) is mapped to human chromosome 12q13. FAIM2 is widely distributed with higher expression in hippocampus. FAIM2 is a membrane-associated protein. The protein is present in the cytoplasm, at the cell membrane and has peri-nuclear staining. FAIM2 is popularly referred as LFG (Lifeguard).

Imunogênio

Fas apoptotic inhibitory molecule 2 recombinant protein epitope signature tag (PrEST)

Aplicação

Anti-FAIM2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)

Ações bioquímicas/fisiológicas

Fas apoptotic inhibitory molecule-2 (FAIM2) is an anti-apoptotic protein which protects from Fas-mediated cell death. FAIM2 is up-regulated in human breast cancer cell lines. The up-regulation of FAIM2 is proposed to suppress apoptosis in breast cancer cells. Anti-apoptotic nature of FAIM2 provides neuroprotection in cerebellar granule neurons and Purkinje cell. Single nucleotide polymorphism in FAIM2 is associated with increased risk of obesity.

Características e benefícios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST74197

forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 1
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable
• Equipamento de proteção individual: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)