HPA014597

Anti-MARCH8 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinônimo(s): Anti-Cellular modulator of immune recognition, Anti-E3 ubiquitin-protein ligase MARCH8, Anti-MARCH-VIII, Anti-Membrane-associated RING finger protein 8, Anti-Membrane-associated RING-CH protein VIII, Anti-RING finger protein 178, Anti-c-MIR
• Código UNSPSC: 12352203
• Número do Atlas de Proteínas Humanas: HPA014597
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• linha de produto: Prestige Antibodies^® Powered by Atlas Antibodies
• Formulário: buffered aqueous glycerol solution
• reatividade de espécies: human
• validação aprimorada: recombinant expression; Learn more about Antibody Enhanced Validation
• técnica(s): immunohistochemistry: 1:50-1:200; western blot: 0.04-0.4 μg/mL
• sequência de imunogênio: VQCKVYVQLWKRLKAYNRVIYVQNCPETSKKNIFEKSPLTEPNFENKHGHGICHSDTNSSCCTEPEDTGAEIIHV
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... MARCH8(220972)

Descrição

Descrição geral

Membrane-associated RING-CH 8 (MARCH8) is a member of the MARCH family of transmembrane proteins, which function as ubiquitin ligases. It has the RING-CH domain in its N-terminal which faces the cytosol. Its C-terminal contains a six amino acid domain, which is conserved across many species. This protein has a wide range of tissue expression. It is localized to the cell membrane and endosomes.

Imunogênio

E3 ubiquitin-protein ligase MARCH8 recombinant protein epitope signature tag (PrEST)

Aplicação

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Ações bioquímicas/fisiológicas

Membrane-associated RING-CH 8 (MARCH8) is involved in endosomal trafficking and the regulation of the expression of their substrates at the cell surface. It ubiquitinates tumor necrosis factor-related apoptosis inducing ligand (TRAIL) receptor 1, and decreases its expression and thus, controls its steady-state expression. It recognizes and binds with the transmembrane domain of transferrin receptor (TfR), and ubiquitinates and down-regulates it. MARCH8 also determines the fate of the clathrin-independent cargo, as well as their recycling and degradation. When expressed, it ubiquitinates and directs CD98 to lysosomes and late endosomes. It ubiquitinates and degrades IL-1 receptor accessory protein (IL1RAP), which leads to the down-regulation of IL-1β and the related pathways such as, NF-κB. It also regulates the turnover of CD81 and CD44, which are ubiquitously expressed proteins.

Características e benefícios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST72948

forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 1
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable
• Equipamento de proteção individual: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)