Pular para o conteúdo
Merck
Todas as fotos(1)

Documentos

HPA014395

Sigma-Aldrich

Anti-GRIK2 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinônimo(s):

Anti-EAA4, Anti-Excitatory amino acid receptor 4, Anti-GluR-6, Anti-GluR6, Anti-Glutamate receptor 6, Anti-Glutamate receptor, ionotropic kainate 2 precursor

Faça loginpara ver os preços organizacionais e de contrato


About This Item

Código UNSPSC:
12352203
Número do Atlas de Proteínas Humanas:
NACRES:
NA.43

fonte biológica

rabbit

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

linha de produto

Prestige Antibodies® Powered by Atlas Antibodies

forma

buffered aqueous glycerol solution

reatividade de espécies

human

técnica(s)

immunohistochemistry: 1:50- 1:200

sequência de imunogênio

LEKRSFCSAMVEELRMSLKCQRRLKHKPQAPVIVKTEEVINMHTFNDRRLPGKE

nº de adesão UniProt

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... GRIK2(2898)

Descrição geral

GRIK2 (glutamate receptor, ionotropic, kainate 2) is a kainate type receptor, belonging to the family of glutamate ion channel receptors. Kainate receptor subtype contains five member subunits naming from GLuK1 to GLuK5. GRIK2 is also called GluK2 or GluR6. This protein has three different isoforms, differing in their C-termini. The longest isoform called GluK2a is composed of 908 amino acids. This gene is localized to human chromosome 6, spans ~670kb, and has 17 exons. The corresponding mRNA is expressed in dentate gyrus, cornu ammonis 3 (CA3) in the pyramidal neurons, cell layer of cerebellar granule, and neocortical regions of the brain.

Imunogênio

Glutamate receptor, ionotropic kainate 2 precursor recombinant protein epitope signature tag (PrEST)

Aplicação

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Ações bioquímicas/fisiológicas

GRIK2 (glutamate receptor, ionotropic, kainate 2) is a receptor which regulates the neurotransmission through excitatory neurotransmitters in brain. Mutation M867I, which causes replacement of methionine-to-isoleucine at position 867, is associated with autism. Studies show that polymorphisms in this gene are linked to various mental disorders such as, schizophrenia, early-onset Huntington′s disease, and autosomal recessive mental retardation. Variants of this gene are also the causatives of obsessive-compulsive disorder (OCD). The tyrosine residue of GRIK2 is phosphorylated by Src, post brain ischemia. This phosphorylation causes an increase in Ca2+ influx and cell currents. It also activates downstream pro-apoptotic signaling, and thus, might have a role in the pathology of ischemic stroke. The ACAG haplotype in GRIK2 gene is linked with somatic anxiety.

Características e benefícios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST72944

forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Not finding the right product?  

Try our Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 1

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Equipamento de proteção individual

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Certificados de análise (COA)

Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Ji-Hyun Lee et al.
Biochemical and biophysical research communications, 424(3), 404-408 (2012-07-10)
Huntington's disease is a neurodegenerative disorder caused by an expanded CAG trinucleotide repeat whose length is the major determinant of age at onset but remaining variation appears to be due in part to the effect of genetic modifiers. GRIK2, which
Woojae Myung et al.
Psychiatry research, 198(3), 400-406 (2012-03-21)
The heritability of some individual depressive symptoms has been well established. However, the causal genes related to individual depressive symptoms and genetic effects on the courses of individual depressive symptoms are still unclear. We examined these issues in 241 Korean
Qiu-Ju Zhu et al.
Proceedings of the National Academy of Sciences of the United States of America, 111(38), 13990-13995 (2014-09-10)
Although kainate receptors play important roles in ischemic stroke, the molecular mechanisms underlying postischemic regulation of kainate receptors remain unclear. In this study we demonstrate that Src family kinases contribute to the potentiation of kainate receptor function. Brain ischemia and
Aline S Sampaio et al.
CNS neuroscience & therapeutics, 17(3), 141-147 (2010-04-08)
Several studies support a genetic influence on obsessive-compulsive disorder (OCD) etiology. The role of glutamate as an important neurotransmitter affecting OCD pathophysiology has been supported by neuroimaging, animal model, medication, and initial candidate gene studies. Genes involved in glutamatergic pathways
Yan Han et al.
Biochemistry, 49(43), 9207-9216 (2010-09-25)
GluK2 is a kainate receptor subunit that is alternatively spliced at the C-terminus. Previous studies implicated GluK2 in autism. In particular, the methionine-to-isoleucine replacement at amino acid residue 867 (M867I) that can only occur in the longest isoform of the

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica