Pular para o conteúdo
Merck
Todas as fotos(2)

Documentos

HPA012716

Sigma-Aldrich

Anti-QSOX2 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinônimo(s):

Anti-Neuroblastoma-derived sulfhydryl oxidase, Anti-Quiescin Q6-like protein 1, Anti-Sulfhydryl oxidase 2 precursor

Faça loginpara ver os preços organizacionais e de contrato


About This Item

Código UNSPSC:
12352203
Número do Atlas de Proteínas Humanas:
NACRES:
NA.41

fonte biológica

rabbit

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

linha de produto

Prestige Antibodies® Powered by Atlas Antibodies

forma

buffered aqueous glycerol solution

reatividade de espécies

human

validação aprimorada

RNAi knockdown
Learn more about Antibody Enhanced Validation

técnica(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500

sequência de imunogênio

LWKKHNMVNGRLAGHLSEDPRFPKLQWPTPDLCPACHEEIKGLASWDEGHVLTFLKQHYGRDNLLDTYSADQGDSSEGGTLARGEEEEKRLTPPEVSHGDRDTQSVRPPGALGPRPALPESLHHSLDGKL

nº de adesão UniProt

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... QSOX2(169714)

Descrição geral

The gene encoding quiescin Q6 sulfhydryl oxidase 2 (QSOX2) contains 12 exons and is localized to chromosome 9q34.3. It belongs to the sulfhydryl oxidase/Quiescin6 family. QSOX2 contains a signal sequence, a protein-disulfide-isomerase-type thioredoxin domain and yeast essential for respiration and vegetative growth protein 1 (ERV1) domain. It is expressed in the plasma and nuclear membrane.

Imunogênio

Sulfhydryl oxidase 2 precursor recombinant protein epitope signature tag (PrEST)

Aplicação

Anti-QSOX2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige. Anti-QSOX2 antibody produced in rabbit can also be used for immunocytochemistry.

Ações bioquímicas/fisiológicas

Quiescin Q6 sulfhydryl oxidase 2 (QSOX2) catalyzes the oxidation of sulfhydryl groups of thiols in peptides and proteins to disulfides, with the reduction of molecular oxygen to hydrogen peroxide. It plays a major role in sensitization of neuroblastoma cells to interferon gamma (IFN-γ)-induced apoptosis.

Características e benefícios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST72164

forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 1

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Equipamento de proteção individual

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Certificados de análise (COA)

Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Isabel Wittke et al.
Cancer research, 63(22), 7742-7752 (2003-11-25)
In neuroblastoma cells, apoptotic programs can be activated by cytokines and cytostatic drugs. Apoptotic dysfunction confers resistance against therapeutic drugs and is a major complication for achieving optimal therapy response. Deregulated expression of the MYCN gene is a critical determinant

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica