HPA012323

Anti-CSF1R antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinônimo(s): CSF1R Antibody - Anti-CSF1R antibody produced in rabbit, Csf1R Antibody, Anti-CD115 antigen, Anti-CSF-1-R, Anti-Fms proto-oncogene, Anti-Macrophage colony-stimulating factor 1 receptor precursor, Anti-c-fms
• Número MDL: MFCD00282160
• Código UNSPSC: 12352203
• Número do Atlas de Proteínas Humanas: HPA012323
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• linha de produto: Prestige Antibodies^® Powered by Atlas Antibodies
• Formulário: buffered aqueous glycerol solution
• reatividade de espécies: human
• validação aprimorada: recombinant expression; Learn more about Antibody Enhanced Validation
• técnica(s): immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:50-1:200
• sequência de imunogênio: NFDVFLQHNNTKLAIPQQSDFHNNRYQKVLTLNLDQVDFQHAGNYSCVASNVQGKHSTSMFFRVVESAYLNLSSEQNLIQEVTVGEGLNLKVMVEAYPGLQGFNWTYLGPFSDHQP
• nº de adesão UniProt: P07333
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... CSF1R(1436)

Descrição

Descrição geral

CSF1R (Colony stimulating factor 1 receptor), a type III receptor tyrosine kinase, is a member of the platelet-derived growth factor (PDGF) receptor family. Structurally, it is composed of five immunoglobulin-like domains, a transmembrane domain, a juxtamembrane domain (JM) and a protein kinase domain separated into two parts by an insert domain (KID).

CSF1R is located on human chromosome 5q32.

Imunogênio

Macrophage colony-stimulating factor 1 receptor precursor recombinant protein epitope signature tag (PrEST)

Aplicação

Anti-CSF1R antibody has been used:

• in cell lysis
• in immunoprecipitation
• in western blotting
• in immunohistochemical analysis

Ações bioquímicas/fisiológicas

CSF1R (Colony stimulating factor 1 receptor) is a major molecule in the innate immunity, cancer, and inflammatory diseases, including systemic lupus erythematosus, arthritis, atherosclerosis and obesity. It regulates developmental activities including cell survival, proliferation, differentiation, and function of mononuclear phagocytes. It has been reported that CSF-1 autocrine loop helps to activate macrophages. In actual state, it exists as an autoinhibited form, and upon activation, it dimerizes. Later, it autophosphorylates tyrosine residues in the intracellular domain, followed by the recruitment of signaling molecules as well as internalization of the receptor. Mutation in the CSF1R causes several diseases including myeloid malignancies.

Características e benefícios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST86535

forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 1
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable
• Equipamento de proteção individual: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)