HPA008819

Anti-PEBP1 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinônimo(s): Anti-HCNPpp, Anti-Neuropolypeptide h3, Anti-PEBP-1, Anti-Phosphatidylethanolamine-binding protein 1, Anti-Prostatic-binding protein, Anti-RKIP, Anti-Raf kinase inhibitor protein
• Código UNSPSC: 12352203
• Número do Atlas de Proteínas Humanas: HPA008819
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• linha de produto: Prestige Antibodies^® Powered by Atlas Antibodies
• forma: buffered aqueous glycerol solution
• reatividade de espécies: human
• validação aprimorada: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• técnica(s): immunohistochemistry: 1:200- 1:500
• sequência de imunogênio: PTQVKNRPTSISWDGLDSGKLYTLVLTDPDAPSRKDPKYREWHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTGLHRYVWLVYEQDRPLKCDEPILSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLY
• nº de adesão UniProt: P30086
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... PEBP1(5037)

Descrição

Descrição geral

PEBP1 (phosphatidylethanolamine binding protein 1), also called Raf kinase inhibitory protein (RKIP), is a member of the PEBP class of proteins. This class was initially identified as the class of proteins specifically interacting with phosphatidylethanolamine phospholipid. This class contains two members- PEBP1 and PEBP4. This protein exists in multiple conformations and has a molecular weight of 21kDa.

Imunogênio

Phosphatidylethanolamine-binding protein 1 recombinant protein epitope signature tag (PrEST)

Aplicação

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Ações bioquímicas/fisiológicas

PEBP1 (phosphatidylethanolamine binding protein 1) binds with and prevents the phosphorylation of Raf-1 protein, which is a suppressor of mitogen activated protein kinase (MAPK) pathway. Thus, it indirectly prevents the activation of MAPK-extracellular signal-regulated kinase (ERK) signaling, and functions as an anti-inflammatory protein. Therefore, the interaction of PEBP1 protein with phospholipids, proteins and fatty acids might have a role in asthma and diabetes. It also acts as a negative regulator of β-adrenergic signaling and NFκB signaling, and acts as the regulator of the mammalian kinome. Inactivation of this gene might result in metastatic cancer, chromosomal abnormalities, systemic inflammatory response syndrome, cardiac and Alzheimer′s disease. Its loss of function also leads to colonization by Helicobacter pylori, which leads to the death of gastric epithelial cells.

Características e benefícios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST71549

forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 1
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable
• Equipamento de proteção individual: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)