Pular para o conteúdo
Merck
Todas as fotos(6)

Documentos Principais

HPA007865

Sigma-Aldrich

Anti-BCAN antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinônimo(s):

Anti-Brain-enriched hyaluronan-binding protein antibody produced in rabbit, Anti-Brevican core protein precursor antibody produced in rabbit, Anti-Protein BEHAB antibody produced in rabbit

Faça loginpara ver os preços organizacionais e de contrato


About This Item

Código UNSPSC:
12352203
Número do Atlas de Proteínas Humanas:
NACRES:
NA.41

fonte biológica

rabbit

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

linha de produto

Prestige Antibodies® Powered by Atlas Antibodies

Formulário

buffered aqueous glycerol solution

reatividade de espécies

human

validação aprimorada

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

técnica(s)

immunohistochemistry: 1:200-1:500

sequência de imunogênio

ACYGDMDGFPGVRNYGVVDPDDLYDVYCYAEDLNGELFLGDPPEKLTLEEARAYCQERGAEIATTGQLYAAWDGGLDHCSPGWLADGSVRYPIVTPSQRCGGGLPGVKTLFLFPNQTGFPNKHSRFNVYCFR

nº de adesão UniProt

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... BCAN(63827)

Descrição geral

BCAN (brevican) gene encodes a chondroitin sulfate proteoglycan that is a member of the aggrecan/versican family. The gene is mapped to human chromosome 1q31. The N-terminal region contains a hyaluronic acid-binding domain. An epidermal growth factor-like repeat, a lectin-like and a complement regulatory protein-like domains are present at the C-terminal region. It is the smallest core protein in this family and is expressed in the developing and adult brain. It is expressed in primary cerebellar astrocytes but not in neurons. The core protein has a molar mass of 145kDa and the N terminally truncated form has a molar mass of 80Da.

Imunogênio

Brevican core protein precursor recombinant protein epitope signature tag (PrEST)

Aplicação

Anti-BCAN antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunofluorescence (1 paper)
Western Blotting (1 paper)

Ações bioquímicas/fisiológicas

Brevican is a proteoglycan that functions in the formation of extracellular matrix in the brain. Its expression in the brain increases as the brain develops. It plays a role in the maintenance of the extracellular environment of mature brain. The proteoglycans function in cell-cell and cell-matrix interactions in the brain.

Características e benefícios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST71572

forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 1

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Equipamento de proteção individual

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Y Yamaguchi
Perspectives on developmental neurobiology, 3(4), 307-317 (1996-01-01)
A diverse set of proteoglycans is expressed in the developing and adult brain. This is in stark contrast to the fact that most extracellular matrix components, including fibronectin, laminin, and collagens, are not expressed in adult brain parenchyma. This suggests
P Milev et al.
Biochemical and biophysical research communications, 247(2), 207-212 (1998-06-27)
We have used a slot-blot radioimmunoassay to quantitate the levels of hyaluronan-binding chondroitin sulfate proteoglycans in developing rat brain from embryonic day 14 (E 14) to eight months postnatal. Recombinant nonhomologous regions of the core proteins were used for immunization
H Yamada et al.
The Journal of biological chemistry, 269(13), 10119-10126 (1994-04-01)
To clone novel brain proteoglycans, we employed a strategy based on polyclonal antisera that recognize multiple proteoglycan core proteins. By using an antiserum raised against a fraction enriched for proteoglycans, we isolated three groups of cDNAs from a bovine brain
Massimiliano Monticone et al.
BMC cancer, 12, 358-358 (2012-08-21)
Most patients affected by Glioblastoma multiforme (GBM, grade IV glioma) experience a recurrence of the disease because of the spreading of tumor cells beyond surgical boundaries. Unveiling mechanisms causing this process is a logic goal to impair the killing capacity
Josef Zamecnik et al.
The European journal of neuroscience, 36(1), 2017-2024 (2012-04-28)
Focal cortical dysplasias (FCDs) of the brain are recognized as a frequent cause of intractable epilepsy. To contribute to the current understanding of the mechanisms of epileptogenesis in FCD, our study provides evidence that not only cellular alterations and synaptic

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica