HPA004940

Anti-AATF antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinônimo(s): Anti-BFR2, Anti-CHE-1, Anti-CHE1, Anti-DED
• Código UNSPSC: 12352203
• Número do Atlas de Proteínas Humanas: HPA004940
• NACRES: NA.43

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• linha de produto: Prestige Antibodies^® Powered by Atlas Antibodies
• Formulário: buffered aqueous glycerol solution
• reatividade de espécies: human
• técnica(s): immunohistochemistry: 1:50- 1:200
• sequência de imunogênio: SVQSISDFEKFTKGMDDLGSSEEEEDEESGMEEGDDAEDSQGESEEDRAGDRNSEDDGVVMTFSSVKVSEEVEKGRAVKNQIALWDQLLEGRIKLQKALLTTNQLPQPDVFPLFKDKGGPEFSSALKNSHKALKALLTSLVGLQ
• nº de adesão UniProt: Q9NY61
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... AATF(26574)

Descrição

Descrição geral

Apoptosis antagonizing transcription factor (AATF) is a 73kDa nuclear phosphoprotein, which is made of 523 amino acids. Human AATF consists of a leucine zipper, many phosphorylation sites, putative nuclear localization signal- NLS1 and NLS2 and three motifs, which bind to nuclear receptors. The leucine zipper lies within residues 239- 260, and putative NLS within residues 300 and 467. AATF has an acidic N- terminal domain with two very acidic regions from residues 20-49 and 107-170, and these regions are separated by a Ser/Thr-rich domain. AATF is also known as Che-1, and in humans, it is located on chromosome 17q11.2-q12.

Imunogênio

Protein AATF recombinant protein epitope signature tag (PrEST)

Aplicação

Anti-AATF antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Ações bioquímicas/fisiológicas

AATF was initially identified to interact with DAP like kinase (Dlk) and it interferes with Dlk- induced apoptosis. AATF has an essential role in the early steps of embryogenesis. It also interacts with transcription factors as an adaptor to promote transcription. AATF is activated by ER (endoplasmic reticulum) stress through PERK signalling, which in turn activates v-akt murine thymoma viral oncogene homolog 1 (AKT1) via STAT3, leading to cell survival and cell resistance to ER stress. AATF and Wolfram syndrome 1 (WFS1) genes have also been shown to crosstalk, and therefore deficiencies in either gene mediate apoptosis in Wolfram syndrome. AATF might also act as a neuroprotective agent as its suppression by Aβ protein in cortical neuronal cells increases Aβ toxicity in these cells. AATF also interacts with Par-4 (prostate apoptosis response-4) and prevents the aberrant production of Aβ-42 peptide by Par-4.

Características e benefícios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST86928

forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 1
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable
• Equipamento de proteção individual: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)