HPA000904

Anti-GMPR2 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinônimo(s): Anti-GMPR2), transcript variant 2, mRNA, Anti-NM_001002000.1, Anti-guanosine monophosphate reductase 2
• Código UNSPSC: 12352203
• Número do Atlas de Proteínas Humanas: HPA000904
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• linha de produto: Prestige Antibodies^® Powered by Atlas Antibodies
• forma: buffered aqueous glycerol solution
• reatividade de espécies: human
• técnica(s): immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:20-1:50
• sequência de imunogênio: YPQLSAVMECADAAHGLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYAGGVAEYRASEGKTVEVPFKGDVEHTIRDILGGIRSTCTYVGAAKLKELSRRTTFIRVTQQV
• nº de adesão UniProt: Q9P2T1
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... GMPR2(51292)

Descrição

Descrição geral

The GMPR2 (guanosine monophosphate reductase 2) gene is mapped to human chromosome 14. The encoded protein is a homotetramer spanning a length of 348 amino acid residues. Each monomer has 11 α-helices and 14 β-sheets. It forms an eight-stranded α/β barrel core. The N and C-terminal sections are attched to this core. Some highly conserved hydrophilic residues of GMPR family are present in this core, making it highly stable.

Imunogênio

GMP reductase 2 (Guanosine 5′-monophosphate oxidoreductase 2) (Guanosine monophosphate reductase 2) recombinant protein epitope signature tag (PrEST)

Aplicação

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Ações bioquímicas/fisiológicas

The gene GMPR2 encodes an isozyme of the enzyme guanosine monophosphate reductase (GMPR). It requires NADPH as the coenzyme for its activity. GMPR catalyzes the conversion of nucleoside and nucleotide derivatives of guanine to adenine nucleotides. It maintains the intercellular homeostasis between adenine and guanine. GMPR2 is a novel human GMP reductase and its overexpression can promote the monocytic differentiation of HL-60 leukemia cells. The protein expression is significantly associated with basal-like tumours (BP) at the transcriptome level. Loss of expression of GMPR2 is associated with BP at the protein level and it may have a role in carcinogenesis.

Características e benefícios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST70437

forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 1
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable
• Equipamento de proteção individual: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)