C8490
CRG-2 from mouse
BioReagent, recombinant, expressed in E. coli, ≥97% (SDS-PAGE), lyophilized powder, suitable for cell culture
Sinônimo(s):
CXCL10, Cytokine Responsive Gene 2, IP-10
Faça loginpara ver os preços organizacionais e de contrato
About This Item
Produtos recomendados
recombinante
expressed in E. coli
Nível de qualidade
linha de produto
BioReagent
Ensaio
≥97% (SDS-PAGE)
forma
lyophilized powder
peso molecular
predicted mol wt ~8.8 kDa
técnica(s)
cell culture | mammalian: suitable
Impurezas
endotoxin, tested
nº de adesão UniProt
temperatura de armazenamento
−20°C
Informações sobre genes
mouse ... Cxcl10(15945)
Descrição geral
Recombinant Mouse CRG-2 is produced from a DNA sequence encoding the mature mouse CRG-2/IP-10 protein sequence (MIPLARTVRCNCHIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTI KNLMKAFSQKRSKRAP). The methionyl form of the E. coli-expressed mature CRG-2 contains 78 amino acid residues and has a predicted molecular mass of approximately 8.8 kDa.
Recombinant Mouse CRG-2 (IP-10, CXCL10) is a member of the chemokine ??subfamily that lacks the ELR domain. Mouse CRG-2 cDNA encodes a 98 amino acid residue precursor protein with a 21 amino acid residue signal peptide that is cleaved to form the 77 amino acid residue secreted mature protein. Mature mouse CRG-2 shares approximately 67% amino acid sequence identity with human IP-10.
Recombinant Mouse CRG-2 (IP-10, CXCL10) is a member of the chemokine ??subfamily that lacks the ELR domain. Mouse CRG-2 cDNA encodes a 98 amino acid residue precursor protein with a 21 amino acid residue signal peptide that is cleaved to form the 77 amino acid residue secreted mature protein. Mature mouse CRG-2 shares approximately 67% amino acid sequence identity with human IP-10.
forma física
Lyophilized from a 0.2 μm filtered solution in PBS, pH 7.4, containing 50 μg bovine serum albumin per 1 μg of cytokine
Nota de análise
The biological activity is measured by its ability to chemoattract human lymphocytes cultured in the presence of IL-2 for 21 days, or mouse BaF/3 cells transfected with hCXCR-3.
Código de classe de armazenamento
11 - Combustible Solids
Classe de risco de água (WGK)
WGK 3
Ponto de fulgor (°F)
Not applicable
Ponto de fulgor (°C)
Not applicable
Equipamento de proteção individual
Eyeshields, Gloves, type N95 (US)
Certificados de análise (COA)
Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.
Já possui este produto?
Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.
S Mahalingam et al.
Immunology and cell biology, 78(2), 156-160 (2000-04-13)
MuMig (monokine induced by gamma interferon) and Crg-2 (cytokine responsive gene) are chemokines of the CXC subfamily. They share activity as T and NK cell chemoattractants. Crg-2 has been shown to be inducible by IFN, TNF, IL-1 and LPS, whereas
Yingping Hou et al.
The Journal of investigative dermatology, 135(12), 3060-3067 (2015-07-24)
Recessive dystrophic epidermolysis bullosa (RDEB) is an inherited disorder characterized by skin fragility, blistering, and multiple skin wounds with no currently approved or consistently effective treatment. It is due to mutations in the gene encoding type VII collagen (C7). Using
Y Ohmori et al.
Biochemical and biophysical research communications, 168(3), 1261-1267 (1990-05-16)
Recently, we have isolated and characterized a set of cDNA clones which encode lipopolysaccharide-inducible proteins in murine peritoneal macrophages. Here, we report the sequence and identification of one of these cDNAs previously termed C7. Nucleotide sequence analysis revealed an open
P Vanguri et al.
The Journal of biological chemistry, 265(25), 15049-15057 (1990-09-05)
In order to identify novel proteins produced by activated macrophages, a cDNA library was made from cultures of the mouse macrophage-like cell line RAW 264.7 that had been treated with conditioned medium from mitogen-stimulated spleen cells, and the library was
Takanobu Utsumi et al.
The Journal of urology, 192(2), 567-574 (2014-02-13)
Renal cell carcinoma expresses CXCR3 but the function of CXCR3 in renal cell carcinoma has not been clarified. We explored the function of CXCR3 in renal cell carcinoma and investigated CXCR3 regulating factors. We obtained 56 clinical samples of clear cell
Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.
Entre em contato com a assistência técnica