Pular para o conteúdo
Merck
Todas as fotos(1)

Documentos

AV49119

Sigma-Aldrich

Anti-UGT3A2 antibody produced in rabbit

IgG fraction of antiserum

Sinônimo(s):

Anti-MGC119426, Anti-MGC119429, Anti-UDP glycosyltransferase 3 family, polypeptide A2

Faça loginpara ver os preços organizacionais e de contrato
Todas as fotos(1)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

100

conjugado

unconjugated

forma do anticorpo

IgG fraction of antiserum

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

forma

buffered aqueous solution

peso molecular

59 kDa

reatividade de espécies

human

concentração

0.5 mg - 1 mg/mL

técnica(s)

western blot: suitable

nº de adesão NCBI

NP_777574

nº de adesão UniProt

Q3SY77

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

Informações sobre genes

human ... UGT3A2(167127)

Imunogênio

Synthetic peptide directed towards the N terminal region of human UGT3A2

Aplicação

Anti-UGT3A2 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml.

Ações bioquímicas/fisiológicas

UDP glycosyltransferase 3 family, polypeptide A2 (UGT3A2) belongs to UDP glycosyltransferase family of enzymes that are involved in the metabolism of small lipophilic compounds. UGT3A2 adds sugars from UDP glucose and UDP xylose to a broad range of substrates to enhance their excretion.

Sequência

Synthetic peptide located within the following region: HNVTMLNHKRGPFMPDFKKEEKSYQVISWLAPEDHQREFKKSFDFFLEET

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Certificados de análise (COA)

Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Peter I MacKenzie et al.
Molecular pharmacology, 79(3), 472-478 (2010-11-23)
The human UDP glycosyltransferase (UGT) 3A family is one of three families involved in the metabolism of small lipophilic compounds. Members of these families catalyze the addition of sugar residues to chemicals, which enhances their excretion from the body. The
Robyn Meech et al.
The Journal of biological chemistry, 287(29), 24122-24130 (2012-05-25)
Recent studies in this laboratory characterized the UGT3A family enzymes, UGT3A1 and UGT3A2, and showed that neither uses the traditional UDP-glycosyltransferase UGT co-substrate UDP-glucuronic acid. Rather, UGT3A1 uses GlcNAc as preferred sugar donor and UGT3A2 uses UDP-Glc. The enzymatic characterization

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica