Pular para o conteúdo
Merck
Todas as fotos(2)

Documentos Principais

AV47815

Sigma-Aldrich

Anti-NPNT antibody produced in rabbit

affinity isolated antibody

Sinônimo(s):

Anti-EGFL6L, Anti-NephroNectin, Anti-POEM

Faça loginpara ver os preços organizacionais e de contrato

Selecione um tamanho

100 μL
R$ 3.345,00

R$ 3.345,00


Check Cart for Availability


Selecione um tamanho

Alterar visualização
100 μL
R$ 3.345,00

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

R$ 3.345,00


Check Cart for Availability

fonte biológica

rabbit

Nível de qualidade

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

Formulário

buffered aqueous solution

peso molecular

62 kDa

reatividade de espécies

rat, guinea pig, human, rabbit, mouse, horse, dog

concentração

0.5 mg - 1 mg/mL

técnica(s)

western blot: suitable

nº de adesão NCBI

nº de adesão UniProt

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... NPNT(255743)

Descrição geral

NPNT codes for a nephronectin that is an extracellular matrix protein associated with integrin alpha 8 beta1 in embryonic renal cells. Nephronectin expression has been implicated in diabetic nephropathy and glomerulosclerosis.
Rabbit Anti-NPNT antibody recognizes rabbit, human, mouse, rat, chicken, bovine, and canine NPNT.

Imunogênio

Synthetic peptide directed towards the middle region of human NPNT

Aplicação

Rabbit Anti-NPNT antibody is suitable for western blot applications at a concentration of 1μg/ml

Ações bioquímicas/fisiológicas

NPNT is a functional ligand of integrin alpha-8/beta-1 in kidney development. It regulates with integrin alpha-8/beta-1 the expression of GDNF which is essential for kidney development. It may also play a role in the development and function of various tissues, regulating cell adhesion, spreading and survival through the binding of several integrins.

Sequência

Synthetic peptide located within the following region: TTGLTTIAPAASTPPGGITVDNRVQTDPQKPRGDVFIPRQPSNDLFEIFE

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable


Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Shinya Nakatani et al.
Nephron. Clinical practice, 122(3-4), 114-121 (2013-05-22)
In a previous proteomic study, we detected increased expression of nephronectin in the glomeruli from patients with diabetic nephropathy (DN). The aim of the present study was to clarify the usefulness of determining glomerular expression of nephronectin in kidney disease.
Shinya Nakatani et al.
Nephrology, dialysis, transplantation : official publication of the European Dialysis and Transplant Association - European Renal Association, 27(5), 1889-1897 (2011-12-17)
To date, little proteomic information has been available from the glomeruli of diabetic patients, possibly due to the clinical limitations of renal biopsy in diabetic patients and insufficient quantities of such specimens for proteome analysis. The purpose of the present
R Brandenberger et al.
The Journal of cell biology, 154(2), 447-458 (2001-07-27)
The epithelial-mesenchymal interactions required for kidney organogenesis are disrupted in mice lacking the integrin alpha8beta1. None of this integrin's known ligands, however, appears to account for this phenotype. To identify a more relevant ligand, a soluble integrin alpha8beta1 heterodimer fused

Questions

Reviews

No rating value

Active Filters

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica