Pular para o conteúdo
Merck
Todas as fotos(2)

Documentos Principais

AV45495

Sigma-Aldrich

Anti-CHST1 antibody produced in rabbit

IgG fraction of antiserum

Sinônimo(s):

Anti-C6ST, Anti-Carbohydrate (keratan sulfate Gal-6) sulfotransferase 1, Anti-KS6ST, Anti-KSGal6ST

Faça loginpara ver os preços organizacionais e de contrato

Selecione um tamanho

100 μL
R$ 2.017,00

R$ 2.017,00


Check Cart for Availability


Selecione um tamanho

Alterar visualização
100 μL
R$ 2.017,00

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

R$ 2.017,00


Check Cart for Availability

fonte biológica

rabbit

Nível de qualidade

conjugado

unconjugated

forma do anticorpo

IgG fraction of antiserum

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

Formulário

buffered aqueous solution

peso molecular

47 kDa

reatividade de espécies

guinea pig, dog, mouse, bovine, human, rat

concentração

0.5 mg - 1 mg/mL

técnica(s)

immunohistochemistry: suitable
western blot: suitable

nº de adesão NCBI

nº de adesão UniProt

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... CHST1(8534)

Imunogênio

Synthetic peptide directed towards the N terminal region of human CHST1

Aplicação

Anti-CHST1 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8μg/ml.

Ações bioquímicas/fisiológicas

CHST1 is a sulfotransferase that is localized to Golgi complex. It transfers sulfate from 3′phosphoadenosine 5′phospho-sulfate to the 6-hydroxyl group of N-acetylglucosamine on proteoglycan keratin. CHST1 contributes to the generation of functional L-selectin ligands in vascular endothelial cells.

Sequência

Synthetic peptide located within the following region: SFVGQLFNQHLDVFYLFEPLYHVQNTLIPRFTQGKSPADRRVMLGASRDL

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable


Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

X Li et al.
Journal of leukocyte biology, 69(4), 565-574 (2001-04-20)
Sulfation is an essential component of the selectin ligands, potentially mediated by members of a new family of carbohydrate sulfotransferases. In this study, we assessed the contributions of CHST1, CHST2, CHST3, and CHST4 in producing functional L-selectin ligands. Human umbilical
A Bistrup et al.
The Journal of cell biology, 145(4), 899-910 (1999-05-20)
L-selectin, a lectin-like receptor, mediates rolling of lymphocytes on high endothelial venules (HEVs) in secondary lymphoid organs by interacting with HEV ligands. These ligands consist of a complex of sialomucins, candidates for which are glycosylation- dependent cell adhesion molecule 1

Questions

Reviews

No rating value

Active Filters

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica