AV42287

Anti-FST antibody produced in rabbit

IgG fraction of antiserum

• Sinônimo(s): Anti-FS, Anti-Follistatin
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: IgG fraction of antiserum
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• forma: buffered aqueous solution
• peso molecular: 35 kDa
• reatividade de espécies: sheep, goat, rat, dog, mouse, human, horse, rabbit, guinea pig, bovine
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): western blot: suitable
• nº de adesão NCBI: NP_006341
• nº de adesão UniProt: Q6FHE1
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... FST(10468)

Descrição

Descrição geral

Follistatin is an autocrine glycoprotein component of the inhibin-activin-follistatin axis that mediates many cellular processes via its ability to bind and neutralize members of the TGF-β superfamily such as activin and myostatin/GDF-8.

Especificidade

Anti-FST polyclonal antibody reacts with canine, chicken, bovine, pig, human, mouse, rat, and zebrafish follistatin proteins.

Imunogênio

Synthetic peptide directed towards the C terminal region of human FST

Aplicação

Anti-FST polyclonal antibody is used to tag follistatin protein for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the possible roles of follistatin in the regulation of TGF-β superfamily mediated processes such as those regulated by myostatin/GDF8 and activin.

Ações bioquímicas/fisiológicas

Follistatin is a single-chain gonadal protein that specifically inhibits follicle-stimulating hormone release.Follistatin is a single-chain gonadal protein that specifically inhibits follicle-stimulating hormone release. The single FST gene encodes two isoforms, FST317 and FST344 containing 317 and 344 amino acids respectively, resulting from alternative splicing of the precursor mRNA. In a study in which 37 candidate genes were tested for linkage and association with polycystic ovary syndrome (PCOS) or hyperandrogenemia in 150 families, evidence was found for linkage between PCOS and follistatin.

Sequência

Synthetic peptide located within the following region: SLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCN

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable