AV34537

Anti-KLHL25 antibody produced in rabbit

affinity isolated antibody

• Sinônimo(s): Anti-Kelch-like 25 (Drosophila)
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• Formulário: buffered aqueous solution
• peso molecular: 66 kDa
• reatividade de espécies: human, dog, mouse, rat, guinea pig
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): western blot: suitable
• nº de adesão NCBI: NP_071925
• nº de adesão UniProt: Q9H0H3
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... KLHL25(64410)

Descrição

Descrição geral

KLHL25 is a kelch-like family member that complexes with CUL3 to form E3 ubiquitin ligase complex. This complex is known to target hypophosphorylated 4E-BP1.
Rabbit Anti-KLHL25 antibody recognizes canine, human, mouse, and rat KLHL25.

Imunogênio

Synthetic peptide directed towards the N terminal region of human KLHL25

Aplicação

Rabbit Anti-KLHL25 antibody is suitable for western blot applications at a concentration of 2 μg/ml.

Ações bioquímicas/fisiológicas

KLHL25 is also known as ENC2. It is a BTB/POZ KELCH domain protein

Sequência

Synthetic peptide located within the following region: SRYFEAMFSHGLRESRDDTVNFQDNLHPEVLELLLDFAYSSRIAINEENA

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable