AV32264

Anti-ETV5 (AB1) antibody produced in rabbit

affinity isolated antibody

• Sinônimo(s): Anti-Ets variant gene 5 (Ets-related molecule)
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• forma: buffered aqueous solution
• peso molecular: 58 kDa
• reatividade de espécies: rat, bovine, horse, guinea pig, mouse, rabbit, dog, human
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): immunohistochemistry: suitable; western blot: suitable
• nº de adesão NCBI: NP_004445
• nº de adesão UniProt: P41161
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... ETV5(2119)

Descrição

Descrição geral

ETV5 loss has been linked to spermatogonial stem cell loss and infertility. Rabbit Anti-ETV5 (AB2) antibody recognizes human, mouse, rat, bovine, and canine ETV5.

Rabbit polyclonal anti-ETV5 antibody reacts with human, mouse, rat, bovine, and canine ETS variant gene 5 transcription factors.

Transcription factor ets variant gene 5 (ETV5/ERM) has various function in male reproduction. ETV5 regulates sertolic cell chemokines involved in stem/progenitor spermatogonia maintenance and is essential for spermatogonial stem cell (SSC) self-renewal.

Imunogênio

Synthetic peptide directed towards the N terminal region of human ETV5

Aplicação

Rabbit Anti-ETV5 (AB1) antibody can be used for western blot applications at 1μg/ml.

Rabbit polyclonal anti-ETV5 antibody is used to tag ETS variant gene 5 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of ETS variant gene 5 in spermatogonia maintenance and self-renewal.

Ações bioquímicas/fisiológicas

ETV5 Contains 1 ETS DNA-binding domain and belongs to the ETS family. The ETV5 gene expression is regulated by the conventional PKC (cPKC) pathway.ETV5 is subject to SUMO modification and this post-translational modification causes inhibition of transcription-enhancing activity Phosphorylated ETV5 and the actin cytoskeleton regulate CD44-mediated hyaluronan binding in myeloid cells. ERMs (ezrin/radixin/moesin) function as adaptor molecules in the interactions of adhesion receptors and intracellular tyrosine kinases. ETV5 can cooperate with c-Jun and has a role in progression of breast cancer

Sequência

Synthetic peptide located within the following region: AQVPDDEQFVPDFQSDNLVLHAPPPTKIKRELHSPSSELSSCSHEQALGA

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable