Pular para o conteúdo
Merck
Todas as fotos(5)

Documentos

AV13034

Sigma-Aldrich

Anti-GABRP antibody produced in rabbit

affinity isolated antibody

Sinônimo(s):

Anti-γ-Aminobutyric acid (GABA) A receptor, pi, Anti-MGC126386, Anti-MGC126387

Faça loginpara ver os preços organizacionais e de contrato
Todas as fotos(5)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

100

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

forma

buffered aqueous solution

peso molecular

51 kDa

reatividade de espécies

dog, rabbit, rat, human, mouse, horse

concentração

0.5 mg - 1 mg/mL

técnica(s)

immunohistochemistry: suitable
western blot: suitable

nº de adesão NCBI

NP_055026

nº de adesão UniProt

O00591

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... GABRP(2568)

Imunogênio

Synthetic peptide directed towards the N terminal region of human GABRP

Aplicação

Anti-GABRP antibody produced in rabbit is suitable for western blotting at a concentration of 1.25 μg/ml.

Ações bioquímicas/fisiológicas

GABRP is a subunit of GABAA receptor, the main inhibitory receptor in the brain. GABAA receptors in mouse taste buds inhibit the secretion of ATP from receptor cells during taste stimulation and are important for growth and differentiation of taste buds.

Sequência

Synthetic peptide located within the following region: VEVGRSDKLSLPGFENLTAGYNKFLRPNFGGEPVQIALTLDIASISSISE

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Certificados de análise (COA)

Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Gennady Dvoryanchikov et al.
The Journal of neuroscience : the official journal of the Society for Neuroscience, 31(15), 5782-5791 (2011-04-15)
Taste buds consist of at least three principal cell types that have different functions in processing gustatory signals: glial-like (type I) cells, receptor (type II) cells, and presynaptic (type III) cells. Using a combination of Ca2+ imaging, single-cell reverse transcriptase-PCR
H Hörtnagl et al.
Neuroscience, 236, 345-372 (2013-01-23)
The GABAA receptor is the main inhibitory receptor in the brain and its subunits originate from different genes or gene families (α1-α6, β1-β3, γ1-γ3, δ, ε, θ, π, or ρ1-3). In the mouse brain the anatomical distribution of GABAA receptor

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica