AV100609

Anti-GLI1 (AB2) antibody produced in rabbit

IgG fraction of antiserum

• Sinônimo(s): Anti-Glioma-associated oncogene homolog 1 (zinc finger protein)
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: IgG fraction of antiserum
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• Formulário: buffered aqueous solution
• peso molecular: 118 kDa
• reatividade de espécies: human, rabbit, horse
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): western blot: suitable
• nº de adesão NCBI: NP_005260
• nº de adesão UniProt: P08151
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... GLI1(2735)

Descrição

Imunogênio

Synthetic peptide directed towards the N terminal region of human GLI1

Aplicação

Anti-GLI1 (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 1.25 μg/ml.

Ações bioquímicas/fisiológicas

GLI1 is a family of zinc finger transcription factors that mediate the effects of Hedgehog pathway. The activation of GLI1 is the effect of the binding of Shh ligand to receptor PTCH. GLI1 has been observed to be overexpressed in glioblastoma and induces the genes involved in tumor development and progression.

Sequência

Synthetic peptide located within the following region: LRPLPSQGAPSVGTEGLSGPPFCHQANLMSGPHSYGPARETNSCTEGPLF

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable