219482

Caveolin-1 Scaffolding Domain Peptide, Cell-permeable

Caveolin-1 scaffolding domain peptide (C1-SD82-101) fused at the N-terminus to the cell-permeable Antennapedia internalization sequence (43-58).

• Sinônimo(s): Caveolin-1 Scaffolding Domain Peptide, Cell-permeable, AP-Cav, Pen-C1-SD, RQIKIWFQNRRMKWKK-DGIWKASFTTFTVTKYWFYR, Cavtratin
• Fórmula empírica (Notação de Hill): C₂₂₈H₃₃₅N₆₁O₄₉S
• Peso molecular: 4746.54
• Código UNSPSC: 12352202
• NACRES: NA.77

Propriedades

• Nível de qualidade: 100
• Ensaio: ≥95% (HPLC)
• Formulário: lyophilized solid
• fabricante/nome comercial: Calbiochem^®
• condição de armazenamento: OK to freeze; desiccated (hygroscopic); protect from light
• cor: white
• solubilidade: DMSO: 2 mg/mL
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C

Descrição

Descrição geral

Caveolin-1 scaffolding domain peptide (C1-SD_82-101) fused at the N-terminus to the cell-permeable Antennapedia internalization sequence (43-58). This peptide is reported to block eNOS activity and cellular NO release in vitro and reduce inflammation and tumorigenesis in vivo. Caveolin-1 interacts with several lipid-modified signaling ligands, such as EGFR, eNOS, G-protein α-subunits, PKCα, H-Ras, and Src, via the C1-SD_82-101 sequence.

Ações bioquímicas/fisiológicas

Cell permeable: yes

Primary Target
eNOS

Product does not compete with ATP.

Reversible: no

Embalagem

Packaged under inert gas

Advertência

Toxicity: Carcinogenic / Teratogenic (D)

Sequência

H-Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Asp-Gly-Ile-Trp-Lys-Ala-Ser-Phe-Thr-Thr-Phe-Thr-Val-Thr-Lys-Tyr-Trp-Phe-Tyr-Arg-OH

forma física

Supplied as a trifluoroacetate salt.

Reconstituição

Following reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.

Outras notas

Bernatchez, P.N., et al. 2005. Proc. Natl. Acad. Sci. USA102, 761.
Williams, T.M., et al. 2004. J. Biol. Chem.279, 51630.
Gratton, J.P., et al. 2003. Cancer Cell4, 31.
Sukumaran, S.K., et al. 2002. J. Biol. Chem.277, 50716.
Liu, J., et al. 2002. J. Biol. Chem.277, 10661.
Bucci, M., et al. 2000. Nat. Med.6, 1362.
Okamoto, T., et al. 1998. J. Biol. Chem.273, 5419.

Informações legais

CALBIOCHEM is a registered trademark of Merck KGaA, Darmstadt, Germany

Informações de segurança

• Código de classe de armazenamento: 11 - Combustible Solids
• Classe de risco de água (WGK): WGK 1
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable