Accéder au contenu
Merck
Toutes les photos(8)

Principaux documents

HPA023881

Sigma-Aldrich

Anti-TFE3 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonyme(s) :

Tfe3 Antibody, Tfe3 Antibody - Anti-TFE3 antibody produced in rabbit, TFEA, bHLHe33

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Numéro MDL:
Code UNSPSC :
12352203
Numéro HPA (Human Protein Atlas):

Source biologique

rabbit

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Gamme de produits

Prestige Antibodies® Powered by Atlas Antibodies

Forme

buffered aqueous glycerol solution

Espèces réactives

human, rat, mouse

Validation améliorée

RNAi knockdown
Learn more about Antibody Enhanced Validation

Technique(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:500-1:1000
western blot: 0.04-0.4 μg/mL

Numéro d'accès UniProt

Application(s)

research pathology

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... TFE3(7030)

Description générale

Transcription factor binding to IGHM enhancer 3 or transcription factor E3 (TFE3) gene is mapped to human chromosome Xp11.23. TFE3 belongs to helix-loop-helix leucine zipper family of transcription factors.

Immunogène

Transcription factor binding to ighm enhancer 3 recombinant protein epitope signature tag (PrEST).

Sequence
SKDLESRQRSLEQANRSLQLRIQELELQAQIHGLPVPPTPGLLSLATTSASDSLKPEQLDIEEEGRPGAATFHVGGGPAQNAPHQQPPAPPSDALLDLHFPSDHLGDLGDPFHLGLEDILMEEEEGVVGGLSGGALSPLRAAS

Application

Anti-TFE3(Transcription factor binding to IGHM enhancer 3) antibody produced in rabbit has been used:
  • in immunofluorescence
  • in immunocytochemistry studies
  • in immunostaining

Actions biochimiques/physiologiques

Transcription factor binding to IGHM enhancer 3 (TFE3) interacts with other transcription factors and plays a key role in cell growth and proliferation. It promotes renal adenocarcinoma progression. TFE3 gene locus is also involved in translocations events resulting in a TFE3 fusion protein, which is a potential marker for screening their prevalence in renal cell carcinomas. It interacts and regulates expression of G-protein Gα16 and favors regulation of claudin 14.

Caractéristiques et avantages

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST74277

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Shogo Wada et al.
Genes & development, 30(22), 2551-2564 (2016-12-04)
Noncanonical mechanistic target of rapamycin (mTOR) pathways remain poorly understood. Mutations in the tumor suppressor folliculin (FLCN) cause Birt-Hogg-Dubé syndrome, a hamartomatous disease marked by mitochondria-rich kidney tumors. FLCN functionally interacts with mTOR and is expressed in most tissues, but
Identification of Transcription Factor E3 (TFE3) as a Receptor-independent Activator of G alpha 16 GENE REGULATION BY NUCLEAR G alpha SUBUNIT AND ITS ACTIVATOR
Sato M, et al.
The Journal of Biological Chemistry, 286(20), 17766-17776 (2011)
ERK-independent African Green monkey pluripotent stem cells in a putative chimera-competent state
De Los Angeles A, et al.
Biochemical and Biophysical Research Communications, 510(1), 78-84 (2019)
Epithelioid hemangioendotheliomas with TFE3 gene translocations are compossible with CAMTA1 gene rearrangements
Lee SJ, et al.
Testing, 7(7), 7480-7480 (2016)
TFE3 regulates renal adenocarcinoma cell proliferation via activation of the mTOR pathway
Fang Y, et al.
Molecular Medicine Reports, 16(3), 2721-2725 (2017)

Questions

Reviews

No rating value

Active Filters

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique