WH0117581M1

Monoclonal Anti-TWIST2 antibody produced in mouse

clone 3C8, purified immunoglobulin, buffered aqueous solution

• Synonym(e): Anti-DERMO1, Anti-MGC117334, Anti-twist homolog 2 (Drosophila)
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: mouse
• Konjugat: unconjugated
• Antikörperform: purified immunoglobulin
• Antikörper-Produkttyp: primary antibodies
• Klon: 3C8, monoclonal
• Form: buffered aqueous solution
• Speziesreaktivität: human
• Methode(n): immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotyp: IgG1κ
• GenBank-Hinterlegungsnummer: BC033168
• UniProt-Hinterlegungsnummer: Q8WVJ9
• Anwendung(en): research pathology
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... TWIST2(117581)

Beschreibung

Allgemeine Beschreibung

Twist family bHLH transcription factor 2 (TWIST2) is part of the basic helix-loop-helix protein (bHLH) family. It acts as a molecular switch by activating or repressing target genes. The TWIST2 gene is localized on human chromosome 2q37.3.

Immunogen

TWIST2 (AAH33168, 1 a.a. ~ 160 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MEEGSSSPVSPVDSLGTSEEELERQPKRFGRKRRYSKKSSEDGSPTPGKRGKKGSPSAQSFEELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDEMDNKMTSCSYVAHERLSYAFSVWRMEGSWSMSASH

Anwendung

Monoclonal Anti-TWIST2 antibody produced in mouse has been used in immunohistochemistry.

Biochem./physiol. Wirkung

Twist family bHLH transcription factor 2 (TWIST2) modulates transcription in mesenchymal cell lineages during development. It interacts with E-protein modulators and binds with E-box on DNA sequences. Mutations in the TWIST2 gene have been linked with Setleis syndrome.

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Rechtliche Hinweise

GenBank is a registered trademark of United States Department of Health and Human Services

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: nwg
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable
• Persönliche Schutzausrüstung: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)