WH0003148M5

Monoclonal Anti-HMGB2 antibody produced in mouse

clone 3E5, purified immunoglobulin, buffered aqueous solution

• Synonym(e): Anti-HMG2, Anti-high-mobility group box 2
• MDL-Nummer: MFCD02263063
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: mouse
• Konjugat: unconjugated
• Antikörperform: purified immunoglobulin
• Antikörper-Produkttyp: primary antibodies
• Klon: 3E5, monoclonal
• Form: buffered aqueous solution
• Speziesreaktivität: human, mouse, rat
• Methode(n): immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• Isotyp: IgG2aκ
• GenBank-Hinterlegungsnummer: BC000903
• UniProt-Hinterlegungsnummer: P26583
• Versandbedingung: dry ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... HMGB2(3148)

Beschreibung

Allgemeine Beschreibung

High-mobility group protein B2 (HMGB2) is also termed as HMG1 (high-mobility group protein 1) and HMG2. This protein has two similar, but distinct HMG boxes (domains A and B) and a long acidic C-terminal tail. HMGB2 is located on human chromosome 4q.

This gene encodes a member of the non-histone chromosomal high mobility group protein family. The proteins of this family are chromatin-associated and ubiquitously distributed in the nucleus of higher eukaryotic cells. In vitro studies have demonstrated that this protein is able to efficiently bend DNA and form DNA circles. These studies suggest a role in facilitating cooperative interactions between cis-acting proteins by promoting DNA flexibility. This protein was also reported to be involved in the final ligation step in DNA end-joining processes of DNA double-strand breaks repair and V(D)J recombination. (provided by RefSeq)

Immunogen

HMGB2 (AAH00903.2, 1 a.a. ~ 195 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEE

Biochem./physiol. Wirkung

High-mobility group protein B2 (HMGB2) plays an important role in several cellular functions, from nuclear re-organization and DNA repair to cellular signaling. High expression of HMGB2 is linked with tumor aggressiveness and prognosis of hepatocellular carcinoma.

Physikalische Form

Solution in phosphate buffered saline, pH 7.4

Rechtliche Hinweise

GenBank is a registered trademark of United States Department of Health and Human Services

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable
• Persönliche Schutzausrüstung: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)