The sequence for product SRP0158, Histone H3 (2-58) human, is as follows:ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKS
Fortfahren mit
Größe auswählen
| Größe/SKU | Verfügbarkeit | Preis |
|---|---|---|
500 μg | Versand in der Regel in 2 Wochen. | € 530,00 |
Über diesen Artikel
biological source
human
recombinant
expressed in E. coli
assay
≥70% (SDS-PAGE)
form
aqueous solution
mol wt
32 kDa
packaging
pkg of 500 μg
storage condition
avoid repeated freeze/thaw cycles
concentration
>0.02 mg/mL
NCBI accession no.
UniProt accession no.
shipped in
dry ice
storage temp.
−70°C
Gene Information
human ... HIST1H3E(8353)
General description
Human Histone 3 (GenBank Accession No. NM_003532), (amino acid 2-58) with N-terminal GST tag, MW = 32kDa, expressed in an Escherichia coli expression system.
Application
Biochem/physiol Actions
Physical form
Preparation Note
1 of 1
Dieser Artikel | |||
|---|---|---|---|
| description recombinant, expressed in E. coli, ≥70% (SDS-PAGE) | description recombinant, expressed in E. coli, ≥80% (SDS-PAGE) | description recombinant, expressed in E. coli, ≥70% (SDS-PAGE) | description ≥90% (HPLC) |
| recombinant expressed in E. coli | recombinant expressed in E. coli | recombinant expressed in E. coli | recombinant - |
| biological source human | biological source human | biological source human | biological source human |
| assay ≥70% (SDS-PAGE) | assay ≥80% (SDS-PAGE) | assay ≥70% (SDS-PAGE) | assay ≥90% (HPLC) |
| concentration >0.02 mg/mL | concentration >0.02 mg/mL | concentration - | concentration >0.02 mg/mL |
| form aqueous solution | form aqueous solution | form aqueous solution | form aqueous solution |
| mol wt 32 kDa | mol wt 15.4 kDa | mol wt 32 kDa | mol wt ~2 kDa |
Hier finden Sie alle aktuellen Versionen:
Besitzen Sie dieses Produkt bereits?
In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.
-
What is the amino acid sequence of Histone H3 (2-58) human, product SRP0158?
1 answer-
Helpful?
-
-
What is the Department of Transportation shipping information for this product?
1 answer-
Transportation information can be found in Section 14 of the product's (M)SDS.To access the shipping information for this material, use the link on the product detail page for the product.
Helpful?
-



