Uniprot P02754 describes beta Lactoglobulin.The first 16 amino acids of that sequence are the signal peptide, so the sequence of beta-Lactoglobulin B corresponds to amino acids 17-178.But Product L7880 is beta-Lactoglobulin A. As shown in the details under the first link, this form of the protein varies by two amino acids from beta-Lactoglobulin B:1. Instead of the glycine (G) at position 80 of the B form, the A form has an aspartic acid (D).2. Instead of the alaline (A) at position 134 of the B form, the A form has a valine (V).So to answer your question, the sequence of Product L7880 is:LIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENDECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLVCQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI
Fortfahren mit
Größe auswählen
| Ihnen/SKU | Verfügbarkeit | Preis |
|---|---|---|
10 mg | Warenkorb auf Verfügbarkeit prüfen | € 102,00 |
25 mg | Warenkorb auf Verfügbarkeit prüfen | € 170,00 |
100 mg | Warenkorb auf Verfügbarkeit prüfen | € 494,00 |
250 mg | Warenkorb auf Verfügbarkeit prüfen | € 1.070,00 |
Über diesen Artikel
€ 102,00
biological source
bovine milk
Quality Segment
assay
≥90% (PAGE)
form
powder
mol wt
18,363 Da by calculation
technique(s)
HPLC: suitable
UniProt accession no.
storage temp.
2-8°C
Gene Information
bovine ... LGB(280838)
General description
Application
- as a calibrant for the calibration of the TriWave device
- as a standard in the detection and quantification of β-lactoglobulin in bovine milk by reverse-phase high performance liquid chromatography (HPLC)
- in the purification and molecular weight measurement of protease samples
Biochem/physiol Actions
1 of 1
Dieser Artikel | |||
|---|---|---|---|
| description ≥90% (PAGE) | description Isoelectric focusing marker, pI 5.1 | description ≥85% (PAGE), lyophilized powder | description ≥90% (PAGE), lyophilized powder |
| assay ≥90% (PAGE) | assay - | assay ≥85% (PAGE) | assay ≥90% (PAGE) |
| biological source bovine milk | biological source bovine milk | biological source bovine milk | biological source bovine milk |
| technique(s) HPLC: suitable | technique(s) isoelectric focusing (IEF): suitable | technique(s) titration: suitable | technique(s) - |
| form powder | form powder | form lyophilized powder | form lyophilized powder |
| mol wt 18,363 Da by calculation | mol wt - | mol wt - | mol wt - |
| UniProt accession no. | UniProt accession no. | UniProt accession no. | UniProt accession no. |
Still not finding the right product?
Explore all of our products under β-Lactoglobulin A aus Kuhmilch
Lagerklasse
11 - Combustible Solids
wgk
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
ppe
Eyeshields, Gloves, type N95 (US)
Hier finden Sie alle aktuellen Versionen:
Besitzen Sie dieses Produkt bereits?
In der Dokumentenbibliothek finden Sie die Dokumentation zu den Produkten, die Sie kürzlich erworben haben.
-
Do you have the amino acid sequence of Product L7880, β-Lactoglobulin A from bovine milk?
1 answer-
Helpful?
-
-
What is the Department of Transportation shipping information for this product?
1 answer-
Transportation information can be found in Section 14 of the product's (M)SDS.To access the shipping information for this material, use the link on the product detail page for the product.
Helpful?
-



