AV41675

Anti-CYP2D6 antibody produced in rabbit

IgG fraction of antiserum

• Synonym(e): Anti-CPD6, Anti-CYP2D, Anti-CYP2D@, Anti-CYP2DL1, Anti-Cytochrome P450, family 2, subfamily D, polypeptide 6, Anti-MGC120389, Anti-MGC120390, Anti-RP4-669P10.2
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: IgG fraction of antiserum
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 55 kDa
• Speziesreaktivität: human, rat
• Konzentration: 0.5 mg - 1 mg/mL
• Methode(n): immunohistochemistry: suitable; western blot: suitable
• NCBI-Hinterlegungsnummer: NP_000097
• UniProt-Hinterlegungsnummer: P10635
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... CYP2D6(1565)

Beschreibung

Allgemeine Beschreibung

Anti-CγP2D6 polyclonal antibody reacts with pig, rabbit, human, mouse, rat, and zebrafish cytochrome P450, family 2, subfamily D, polypeptide 6 proteins.

Cytochrome P450, family 2, subfamily D, polypeptide 6 (CγP2D6) is an important oxidizing enzyme involved in drug metabolism wherein it sometimes functions as a drug activator. CγP2D6 metabolizes drugs in important classes including antidepressants (tricyclics, tetracyclics, SSRIs, SNRIs); opioids; antipsychotics; β-blockers; class I antiarrhythmics and a variety of other drug applications.

Immunogen

Synthetic peptide directed towards the N terminal region of human CYP2D6

Anwendung

Anti-CγP2D6 polyclonal antibody is used to tag cytochrome P450, family 2, subfamily D, polypeptide 6 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of cytochrome P450, family 2, subfamily D, polypeptide 6 proteins in metabolism of many important therapeutic drugs.

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunofluorescence (1 paper)

Biochem./physiol. Wirkung

CYP2D6 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to metabolize as many as 20% of commonly prescribed drugs. Its substrates include debrisoquine, an adrenergic-blocking drug; sparteine and propafenone, both anti-arrythmic drugs; and amitryptiline, an anti-depressant.This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to metabolize as many as 20% of commonly prescribed drugs. Its substrates include debrisoquine, an adrenergic-blocking drug; sparteine and propafenone, both anti-arrythmic drugs; and amitryptiline, an anti-depressant. The gene is highly polymorphic in the population; certain alleles result in the poor metabolizer phenotype, characterized by a decreased ability to metabolize the enzyme′s substrates. The gene is located near two cytochrome P450 pseudogenes on chromosome 22q13.1. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Sequenz

Synthetic peptide located within the following region: RPPVPITQILGFGPRSQGVFLARYGPAWREQRRFSVSTLRNLGLGKKSLE

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable