AV31708

Anti-ZNF609 antibody produced in rabbit

IgG fraction of antiserum

• Synonym(e): Anti-Zinc finger protein 609
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Konjugat: unconjugated
• Antikörperform: IgG fraction of antiserum
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 155 kDa
• Speziesreaktivität: rat, human
• Konzentration: 0.5 mg - 1 mg/mL
• Methode(n): western blot: suitable
• NCBI-Hinterlegungsnummer: NP_055857
• UniProt-Hinterlegungsnummer: O15014
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... ZNF609(23060)

Beschreibung

Allgemeine Beschreibung

ZNF609 is a zinc-finger protein that may function as a p53-regulated target.
Rabbit Anti-ZNF609 antibody recognizes chicken, human, bovine, mouse, and rat ZNF609.

Immunogen

Synthetic peptide directed towards the N terminal region of human ZNF609

Anwendung

Rabbit Anti-ZNF609 antibody can be used for western blot applications at a concentration of 1.25μg/ml.

Biochem./physiol. Wirkung

The function of ZNF609 remains unknown.

Sequenz

Synthetic peptide located within the following region: NIKFVTPVPGPQGKEGKSKSKRSKSGKDTSKPTPGTSLFTPSEGAASKKE

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 12 - Non Combustible Liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable