AV100955

Anti-MBP-1 antibody produced in rabbit

affinity isolated antibody

• Synonym(e): Anti-CIRIP, Anti-HGNC:4920, Anti-MBP-1, Anti-PRDII-BF1, Anti-ZNF40
• UNSPSC-Code: 12352203
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 47 kDa
• Speziesreaktivität: human
• Konzentration: 0.5 mg - 1 mg/mL
• Methode(n): immunohistochemistry: suitable; western blot: suitable
• NCBI-Hinterlegungsnummer: NP_002105
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Angaben zum Gen: human ... MBP-1(3096)

Beschreibung

Allgemeine Beschreibung

Immunodeficiency virus type I enhancer binding protein/cirhin interaction protein/Myc promoter-binding protein-1 (HIVEP1, CIRIP, MBP-1, ZNF40, PRDII-BF1) is a transcription factor involved in the activation of HIV-1 gene expression and the repression of c-myc gene expression.

Immunogen

Synthetic peptide directed towards the middle region of human ENO1

Anwendung

Rabbit polyclonal anti-MBP-1 antibody is used to tag immunodeficiency virus type I enhancer binding protein/cirhin interaction protein/myc promoter-binding protein-1 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of immunodeficiency virus type I enhancer binding protein/cirhin interaction protein/myc promoter-binding protein-1 in HIV-1 and c-myc gene expression. Anti-MBP-1 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5 μg/ml. For immunohistochemistry of paraffin-embedded tissue sections, a concentration of 4-8 μg/ml is suitable.

Rabbit polyclonal anti-MBP-1 antibody reacts with human immunodeficiency virus type I enhancer binding protein/cirhin interaction protein/myc promoter-binding protein-1 transcription factor.

Biochem./physiol. Wirkung

MBP-1 binds to the GGGACTTTCC sequence motif found in enhancer elements of viral promoters. It regulates the transcription of both cellular and viral (HIV-1) genes.

Sequenz

Synthetic peptide located within the following region: GSGGMTHSDQPKEDRQGVNEKSCNCLLLKVNQIGSVTESLQACKLAQANG

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable