AV09053

Anti-SFRP1 antibody produced in rabbit

IgG fraction of antiserum

• Synonym(e): Anti-Secreted frizzled-related protein 1
• NACRES: NA.41
• UNSPSC Code: 12352203
• Conjugate: unconjugated
• Clone: polyclonal
• Application: WB
• Citations: 5

Eigenschaften

• biological source: rabbit
• conjugate: unconjugated
• antibody form: IgG fraction of antiserum
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 35 kDa
• species reactivity: mouse, human, guinea pig, horse, dog, rat
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_003003
• UniProt accession no.: Q8N474
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... SFRP1(6422)

Beschreibung

Immunogen

Synthetic peptide directed towards the middle region of human SFRP1

Application

Anti-SFRP1 antibody produced in rabbit is suitable for western blotting at a concentration of 0.3 μg/ml.

Biochem/physiol Actions

Secreted Frizzled-related protein 1 (SFRP1) is a secreted antagonist of Wnt signaling pathway. It is secreted in excess amounts during DNA damage- or oxidative stress-induced cellular senescence. SFRP1 is a modulator of normal and malignant hematopoiesis and cell proliferation. Gene polymorphisms, aberrations and methylation of SFRP1 is a feature in bladder cancers resulting in excessive activation of Wnt pathway.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: HQLDNLSHHFLIMGRKVKSQYLLTAIHKWDKKNKEFKNFMKKMKNHECPT

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklasse: 10 - Combustible liquids
• wgk: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable