Key Documents

View All Documentation

Anti-TMEM119 antibody produced in rabbit

Name: Anti-TMEM119 antibody produced in rabbit
Brand: SIGMA
Price: 607 USD

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Tmem119 Antibody, Tmem119 Antibody - Anti-TMEM119 antibody produced in rabbit, Anti-transmembrane protein 119

Select a Size

Change View

Pack Size	SKU	Availability	Price
100 μL		Usually ships in 1 week. (Orders outside of US and Europe, please allow an additional 1-2 weeks for delivery)	$607.00

About This Item

UNSPSC Code:

12352203

NACRES:

NA.41

Human Protein Atlas Number:

HPA051870

Conjugate:

unconjugated

Clone:

polyclonal

Application:

IHC

Citations:

$607.00

Usually ships in 1 week. (Orders outside of US and Europe, please allow an additional 1-2 weeks for delivery)

Technical Service

Need help? Our team of experienced scientists is here for you.

Let Us Assist

Properties

biological source

rabbit

Quality Level

100

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies^® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

independent
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunohistochemistry: 1:500-1:1000

immunogen sequence

GDGARMVEGRGAEEEEKGSQEGDQEVQGHGVPVETPEAQEEPCSGVLEGAVVAGEGQGELEGSLLLAQEAQGPVGPPESPCACSSVHPS

UniProt accession no.

Q4V9L6

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... TMEM119(338773)

Description

General description

Transmembrane protein 119 (TMEM119) is encoded by the gene mapped to human chromosome 12q23.3. The encoded protein belongs to the transmembrane protein family. TMEM119 has an O-glycosylated N-terminal region.

Immunogen

transmembrane protein 119 recombinant protein epitope signature tag (PrEST)

Application

Anti-TMEM119 antibody produced in rabbit has been used in immunohistochemistry.

Biochem/physiol Actions

Transmembrane protein 119 (TMEM119) acts as an osteoinductive factor and facilitates proliferation, migration and invasion of osteosarcoma cells.(28} It is a critical molecule acting downstream of the parathyroid hormone (PTH) and similar to mothers against decapentaplegic-3 (Smad3) signaling pathways in osteoblasts. TMEM119 is considered to be a potential microglial marker that differentiates resident microglia from blood-derived macrophages in the human brain. Mutation in the gene is associated with the development of osteosarcoma.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Other Notes

Corresponding Antigen APREST85802

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Compare Similar Items

View Full Comparison

Show Differences

1 of 1

This Item	HPA052650	HPA016830	HPA036982
Sigma-Aldrich HPA051870 Anti-TMEM119 antibody produced in rabbit	Sigma-Aldrich HPA052650 Anti-TMEM119 antibody produced in rabbit	Sigma-Aldrich HPA016830 Anti-TMEM19 antibody produced in rabbit	Sigma-Aldrich HPA036982 Anti-TMEM139 antibody produced in rabbit
Quality Level 100	Quality Level 100	Quality Level 100	Quality Level 100
antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody
biological source rabbit	biological source rabbit	biological source rabbit	biological source rabbit
conjugate unconjugated	conjugate unconjugated	conjugate unconjugated	conjugate unconjugated
product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies
form buffered aqueous glycerol solution	form buffered aqueous glycerol solution	form buffered aqueous glycerol solution	form buffered aqueous glycerol solution

Still not finding the right product?

Explore all of our products under Anti-TMEM119 antibody produced in rabbit

— or —

Try our Product Selector Tool to narrow your options

Storage Class

10 - Combustible liquids

wgk

WGK 1

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

000040628

E106556

R67219

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Search for a COA

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Upregulation and biological function of transmembrane protein 119 in osteosarcoma.

Zhen-Huan Jiang et al.

Experimental & molecular medicine, 49(5), e329-e329 (2017-05-13)

Osteosarcoma is suggested to be caused by genetic and molecular alterations that disrupt osteoblast differentiation. Recent studies have reported that transmembrane protein 119 (TMEM119) contributes to osteoblast differentiation and bone development. However, the level of TMEM119 expression and its roles

Dominant role of microglial and macrophage innate immune responses in human ischemic infarcts.

Tobias Zrzavy et al.

Brain pathology (Zurich, Switzerland), 28(6), 791-805 (2017-12-10)

Inflammatory mechanisms, involving granulocytes, T-cells, B-cells, macrophages and activated microglia, have been suggested to play a pathogenic role in experimental models of stroke and may be targets for therapeutic intervention. However, knowledge on the inflammatory response in human stroke lesions

Involvement of the osteoinductive factors, Tmem119 and BMP-2, and the ER stress response PERK?eIF2??ATF4 pathway in the commitment of myoblastic into osteoblastic cells.

Tanaka K I, et al.

Calcified Tissue International, 94(4), 454-464 (2014)

View All Related Papers

Global Trade Item Number

SKU	GTIN
HPA051870-100UL	04061836304263
HPA051870-25UL	04061841075080

Questions

Reviews

No rating value