HPA026763
Anti-NENF antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Synonym(s):
Anti-Cell immortalization-related protein 2, Anti-Neudesin, Anti-Neuron-derived neurotrophic factor, Anti-SPUF protein, Anti-Secreted protein of unknown function
Sign In to View Organizational & Contract Pricing.
Select a Size
Change View
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| 100 μL | Usually ships in 1 week. (Orders outside of US and Europe, please allow an additional 1-2 weeks for delivery) | $667.00 |
About This Item
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IF, IHC
Citations:
3
$667.00
Usually ships in 1 week. (Orders outside of US and Europe, please allow an additional 1-2 weeks for delivery)
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
technique(s)
immunofluorescence: 0.25-2 μg/mL, immunohistochemistry: 1:20-1:50
immunogen sequence
RLFTEEELARYGGEEEDQPIYLAVKGVVFDVTSGKEFYGRGAPYNALTGKDSTRGVAKMS
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... NENF(29937)
General description
Neuron derived neurotrophic factor (NENF), also called as neudesin and GIG47, is mapped to human chromosome 1p33. This gene is expressed only in vertebrates. NENF codes for a novel secretory protein with 172 amino acids named neudesin. Primary structure of this protein might contain cytochrome b5-like heme/steroid-binding domain. In mouse, neudesin is expressed in heart, kidney, brain, and lung.
Immunogen
Neudesin Precursor recombinant protein epitope signature tag (PrEST)
Application
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Biochem/physiol Actions
Neuron derived neurotrophic factor (NENF) or GIG47 as an oncogene plays a crucial role in human tumorigenesis. It is highly expressed in various human cancer tissues, such as uterine cervix cancer, lymphoma, colon, lung, skin, leukemia and even breast cancer. Neudesin acts as a neurotrophic factor in neurons and undifferentiated neural cells. The neurotrophic property of this protein is transmitted by the activation of mitogen-activated protein (MAP) and phosphatidylinositol 3-kinase (PI-3K) pathways. NENF or neudesin is a primary extracellular heme-binding protein implicated in intercellular signal transduction. In mouse, neudesin plays a vital role in neural cell proliferation and neuronal differentiation.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Other Notes
Corresponding Antigen APREST76694
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
1 of 1
This Item | |||
|---|---|---|---|
| biological source rabbit | biological source rabbit | biological source rabbit | biological source rabbit |
| antibody form affinity isolated antibody | antibody form affinity isolated antibody | antibody form affinity isolated antibody | antibody form affinity isolated antibody |
| conjugate unconjugated | conjugate unconjugated | conjugate unconjugated | conjugate unconjugated |
| Quality Level 100 | Quality Level 100 | Quality Level 100 | Quality Level 100 |
| product line Prestige Antibodies® Powered by Atlas Antibodies | product line - | product line Prestige Antibodies® Powered by Atlas Antibodies | product line Prestige Antibodies® Powered by Atlas Antibodies |
| UniProt accession no. | UniProt accession no. | UniProt accession no. | UniProt accession no. - |
Still not finding the right product?
Explore all of our products under Anti-NENF antibody produced in rabbit
— or —
Try our Product Selector Tool to narrow your options
Storage Class
10 - Combustible liquids
wgk
WGK 1
flash_point_f
Not applicable
flash_point_c
Not applicable
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
The functional and structural characterization of a novel oncogene GIG47 involved in the breast tumorigenesis.
The functional and structural characterization of a novel oncogene GIG47 involved in the breast tumorigenesis.
The functional and structural characterization of a novel oncogene GIG47 involved in the breast tumorigenesis.
Han KH
BMC Cancer, 12:274 (2012)
Neurotrophic activity of neudesin, a novel extracellular heme-binding protein, is dependent on the binding of heme to its cytochrome b5-like heme/steroid-binding domain.
Kimura I
The Journal of Biological Chemistry, 283(7), 4323-4331 (2008)
Neudesin, a secreted factor, promotes neural cell proliferation and neuronal differentiation in mouse neural precursor cells.
Kimura I
Journal of Neuroscience Research, 83(8), 1415-1424 (2006)
Global Trade Item Number
| SKU | GTIN |
|---|---|
| HPA026763-100UL | 04061835674350 |
| HPA026763-25UL | 04061842852000 |