HPA023915
Anti-FAM167A antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Synonym(s):
Anti-C8orf13 antibody produced in rabbit, Anti-UPF0484 protein FAM167A
Sign In to View Organizational & Contract Pricing.
Select a Size
Change View
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| 100 μL | Usually ships in 1 week. (Orders outside of US and Europe, please allow an additional 1-2 weeks for delivery) | $667.00 |
About This Item
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IHC
Citations:
4
$667.00
Usually ships in 1 week. (Orders outside of US and Europe, please allow an additional 1-2 weeks for delivery)
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
enhanced validation
recombinant expression
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 0.04-0.4 μg/mL, immunohistochemistry: 1:20-1:50
immunogen sequence
LRGDINKLKIEHTCRLHRRMLNDATYELEERDELADLFCDSPLASSFSLSTPLKLIGVTKMNINSRRFS
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... C8orf13(83648)
General description
FAM167A (family with sequence similarity 167 member A), also known as C8orf13, is localized to human chromosome 8p23–p22. This gene is ubiquitously expressed and its functional characteristics are yet unknown.
Immunogen
UPF0484 protein FAM167A recombinant protein epitope signature tag (PrEST)
Application
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Biochem/physiol Actions
FAM167A (family with sequence similarity 167 member A)-BLK (B lymphoid-specific tyrosine kinase) region rs13277113A polymorphism was initially identified in patients with SLE (systemic lupus erythematosus) in a genome wide association study (GWAS). Studies in Japanese and Chinese populations show that this gene locus is also linked with polymyositis/dermatomyositis. FAM167A-BLK gene locus is also linked with susceptibility to various autoimmune disorders. rs13277113A allele is also a risk factor for systemic sclerosis.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Other Notes
Corresponding Antigen APREST76287
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
1 of 1
This Item | |||
|---|---|---|---|
| conjugate unconjugated | conjugate unconjugated | conjugate unconjugated | conjugate unconjugated |
| biological source rabbit | biological source rabbit | biological source rabbit | biological source rabbit |
| Quality Level 100 | Quality Level 100 | Quality Level 100 | Quality Level 100 |
| antibody form affinity isolated antibody | antibody form affinity isolated antibody | antibody form affinity isolated antibody | antibody form affinity isolated antibody |
| product line Prestige Antibodies® Powered by Atlas Antibodies | product line Prestige Antibodies® Powered by Atlas Antibodies | product line Prestige Antibodies® Powered by Atlas Antibodies | product line Prestige Antibodies® Powered by Atlas Antibodies |
| shipped in wet ice | shipped in wet ice | shipped in wet ice | shipped in wet ice |
Still not finding the right product?
Explore all of our products under Anti-FAM167A antibody produced in rabbit
— or —
Try our Product Selector Tool to narrow your options
Storage Class
10 - Combustible liquids
wgk
WGK 1
flash_point_f
Not applicable
flash_point_c
Not applicable
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Tomoko Sugiura et al.
PloS one, 9(3), e90019-e90019 (2014-03-19)
Accumulating evidence has shown that several non-HLA genes are involved in the susceptibility to polymyositis/dermatomyositis. This study aimed to investigate the involvement of C8orf13-BLK, one of the strongest candidate genes for autoimmune diseases, in susceptibility to polymyositis/dermatomyositis in the Japanese
Si Chen et al.
Immunologic research, 62(2), 153-162 (2015-04-08)
Idiopathic inflammatory myopathies (IIMs) are autoimmune diseases influenced by genetic background and environmental factors. Recently, FAM167A-BLK gene has been identified as a potential genetic susceptibility locus for dermatomyositis (DM) in patients of European and Japanese populations. Our aim here was
Ikue Ito et al.
Arthritis and rheumatism, 62(3), 890-895 (2010-02-05)
An association of single-nucleotide polymorphisms (SNPs) in the FAM167A (previously referred to as C8orf13)-BLK region with systemic lupus erythematosus (SLE) has been demonstrated in Caucasians and in Asians. Recent studies have shown that many genes, including IRF5, STAT4, and PTPN22
Global Trade Item Number
| SKU | GTIN |
|---|---|
| HPA023915-25UL | 04061841473602 |
| HPA023915-100UL | 04061835672035 |