HPA021085

Anti-RGP1 antibody produced in rabbit

Name: Anti-RGP1 antibody produced in rabbit
Brand: SIGMA
Price: 615 USD

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab2

Synonym(s):

Anti-Retrograde Golgi transport protein RGP1 homolog

Slide 1 of 2

Select a Size

100 μL

$615.00

Usually ships in 1 week. (Orders outside of US and Europe, please allow an additional 1-2 weeks for delivery)

About This Item

UNSPSC Code:

12352203

NACRES:

NA.43

Human Protein Atlas Number:

HPA021085

Key Documents

View All Documentation

Product Name

Anti-RGP1 antibody produced in rabbit, Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab2

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies^® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:500-1:1000

immunogen sequence

SKSYSYSEVLPIEGPPSFRGQSVKYVYKLTIGCQRVNSPITLLRVPLRVLVLTGLQDVRFPQDEAVAPSSPFLEEDEGGKKDS

UniProt accession no.

Q92546

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Compare Similar Items

View Full Comparison

Show Differences

1 of 4

This Item	SAB3500456	SAB1408670	HPA016818
Sigma-Aldrich HPA021085 Anti-RGP1 antibody produced in rabbit	Sigma-Aldrich SAB3500456 Anti-RGP1 antibody produced in rabbit	Sigma-Aldrich SAB1408670 Anti-RGL1 antibody produced in rabbit	Sigma-Aldrich HPA016818 Anti-RRP1 antibody produced in rabbit
Quality Level 100	Quality Level 100	Quality Level 100	Quality Level 100
conjugate unconjugated	conjugate unconjugated	conjugate unconjugated	conjugate unconjugated
antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form purified immunoglobulin	antibody form affinity isolated antibody
biological source rabbit	biological source rabbit	biological source rabbit	biological source rabbit
product line Prestige Antibodies^® Powered by Atlas Antibodies	product line -	product line -	product line Prestige Antibodies^® Powered by Atlas Antibodies
form buffered aqueous glycerol solution	form buffered aqueous solution	form buffered aqueous solution	form buffered aqueous glycerol solution

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Biochem/physiol Actions

RGP1 (RAB6A-GEF complex partner protein 2) forms a complex with RIC1 (RAB6A-GEF complex partner protein 1). Together, they function as a guanine nucleotide exchange factor for the late Golgi Rab6A (ras-related gtp-binding protein 6A) GTPase and an effector of the medial Golgi Rab33B GTPase. Absence of RGP1 destabilizes Rab6 and negatively affects the retrograde transport of mannose 6-phosphate receptors from late endosomes to the Golgi.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

General description

The gene RGP1 (RAB6A-GEF complex partner protein 2) is mapped to human chromosome 9p13.3. It mainly localizes in the cytoplasm.

Immunogen

Retrograde Golgi transport protein RGP1 homolog recombinant protein epitope signature tag (PrEST)

Other Notes

Corresponding Antigen APREST75198

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Not finding the right product?

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

R10748

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Search for a COA

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Bioinformatics and reanalysis of subtracted expressed sequence tags from the human ciliary body: Identification of novel biological functions.

Julio Escribano et al.

Molecular vision, 8, 315-332 (2002-10-02)

The ciliary body is largely known for its major roles in the regulation of aqueous humor secretion, intraocular pressure, and accommodation of the lens. In this review article we applied bioinformatics to re-examine hundreds of expressed sequence tags (ESTs) previously

Ric1-Rgp1 complex is a guanine nucleotide exchange factor for the late Golgi Rab6A GTPase and an effector of the medial Golgi Rab33B GTPase.

Ganesh V Pusapati et al.

The Journal of biological chemistry, 287(50), 42129-42137 (2012-10-24)

Rab GTPases are master regulators of membrane trafficking events and template the directionality of protein transport through the secretory and endocytic pathways. Certain Rabs recruit the guanine nucleotide exchange factor (GEF) that activates a subsequent acting Rab protein in a

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service