Key Documents

Anti-GOSR1 antibody produced in rabbit

Name: Anti-GOSR1 antibody produced in rabbit
Brand: SIGMA
Price: 667 USD

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-28 kDa Golgi SNARE protein, Anti-28 kDa cis-Golgi SNARE p28, Anti-GOS-28, Anti-Golgi SNAP receptor complex member 1

Select a Size

Change View

Pack Size	SKU	Availability	Price
100 μL		Usually ships in 1 week. (Orders outside of US and Europe, please allow an additional 1-2 weeks for delivery)	$667.00

About This Item

UNSPSC Code:

12352203

NACRES:

NA.41

Human Protein Atlas Number:

HPA020590

Conjugate:

unconjugated

Clone:

polyclonal

Application:

IHC

Citations:

$667.00

Usually ships in 1 week. (Orders outside of US and Europe, please allow an additional 1-2 weeks for delivery)

Technical Service

Need help? Our team of experienced scientists is here for you.

Let Us Assist

Properties

biological source

rabbit

Quality Level

100

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies^® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

recombinant expression
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL, immunohistochemistry: 1:50-1:200

immunogen sequence

TGVNDKMAEYTNSAGVPSLNAALMHTLQRHRDILQDYTHEFHKTKANFMAIRERENLMGSVRKDIESYKSGSGVNNRRTELFLKEHDHLRNSDRLIEETISIAMATKENMTSQRGMLKSIHSKMNTLANRFPAVNSLIQRINLRKR

UniProt accession no.

O95249

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... GOSR1(9527)

Description

General description

Golgi SNAP receptor complex member 1 (GOSR1) has a molecular weight of 28kDa. It is part of the Golgi-soluble N-ethylmaleimide-sensitive fusion protein-attachment protein receptor complex (SNARE). The gene encoding this protein is localized on human chromosome 17q11.

Immunogen

Golgi SNAP receptor complex member 1 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Biochem/physiol Actions

Golgi SNAP receptor complex member 1 (GOSR1) has an important role in vesicle transport from the endoplasmic reticulum to the Golgi apparatus. It binds to tumor suppressor p53 and stabilizes it.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST78866

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Compare Similar Items

View Full Comparison

Show Differences

1 of 1

This Item	SAB1400352	HPA054472	HPA011929
Sigma-Aldrich HPA020590 Anti-GOSR1 antibody produced in rabbit	$Anti-GOSR1 antibody produced in mouse IgG fraction of antiserum, buffered aqueous solution$ Sigma-Aldrich SAB1400352 Anti-GOSR1 antibody produced in mouse	Sigma-Aldrich HPA054472 Anti-GOSR2 antibody produced in rabbit	Sigma-Aldrich HPA011929 Anti-GOLM1 antibody produced in rabbit
biological source rabbit	biological source mouse	biological source rabbit	biological source rabbit
antibody form affinity isolated antibody	antibody form IgG fraction of antiserum	antibody form affinity isolated antibody	antibody form affinity isolated antibody
Quality Level 100	Quality Level 100	Quality Level 100	Quality Level 100
conjugate unconjugated	conjugate unconjugated	conjugate unconjugated	conjugate unconjugated
product line Prestige Antibodies^® Powered by Atlas Antibodies	product line -	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies
species reactivity human	species reactivity human	species reactivity human	species reactivity human

Still not finding the right product?

Try our Product Selector Tool to narrow your options

Storage Class

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

R10095

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Search for a COA

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

cDNA characterization and chromosomal mapping of human golgi SNARE GS27 and GS28 to chromosome 17.

T D Bui et al.

Genomics, 57(2), 285-288 (1999-04-13)

Transport of proteins along the exocytotic pathway is primarily achieved by vesicular intermediates. Two proteins, Golgi SNAREs of 27 kDa, GS27, and of 28 kDa, GS28 (HGMW-approved nomenclature GOSR2 and GOSR1, respectively), are important trafficking membrane proteins between the endoplasmic

Golgi-SNARE GS28 potentiates cisplatin-induced apoptosis by forming GS28-MDM2-p53 complexes and by preventing the ubiquitination and degradation of p53.

Nian-Kang Sun et al.

The Biochemical journal, 444(2), 303-314 (2012-03-09)

In the present study, we observed that the Golgi-SNARE (soluble N-ethylmaleimide-sensitive fusion protein-attachment protein receptor) GS28 forms a complex with p53 in HEK (human embryonic kidney)-293 cells. Given that p53 represents a tumour suppressor that affects the sensitivity of cancer

Global Trade Item Number

SKU	GTIN
HPA020590-100UL	04061835684298
HPA020590-25UL	04061842874484

Questions

Reviews

No rating value