Key Documents

Anti-DNAJC14 antibody produced in rabbit

Name: Anti-DNAJC14 antibody produced in rabbit
Brand: SIGMA
Price: 667 USD

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-DRiP78, Anti-DnaJ homolog subfamily C member 14, Anti-DnaJ protein homolog 3, Anti-Dopamine receptor-interacting protein of 78 kDa, Anti-HDJ-3

Select a Size

Change View

Pack Size	SKU	Availability	Price
100 μL		Usually ships in 1 week. (Orders outside of US and Europe, please allow an additional 1-2 weeks for delivery)	$667.00

About This Item

UNSPSC Code:

12352203

NACRES:

NA.41

Human Protein Atlas Number:

HPA017653

Conjugate:

unconjugated

Clone:

polyclonal

Application:

IHC

Citations:

$667.00

Usually ships in 1 week. (Orders outside of US and Europe, please allow an additional 1-2 weeks for delivery)

Technical Service

Need help? Our team of experienced scientists is here for you.

Let Us Assist

Properties

biological source

rabbit

Quality Level

100

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies^® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

mouse, rat, human

technique(s)

immunoblotting: 0.04-0.4 μg/mL, immunohistochemistry: 1:200-1:500

immunogen sequence

WGWLELPWVKQNINRQGNAPVASGRYCQPEEEVARLLTMAGVPEDELNPFHVLGVEATASDVELKKAYRQLAVMVHPDKNHHPRAEEAFKVLRAAWDIVSNAEKRKEYEMKRMAENELSRSVNEFLSKLQDDLKEAMNTMMCSRCQG

UniProt accession no.

Q6Y2X3

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... DNAJC14(85406)

Description

General description

DNAJC14 (DnaJ heat shock protein family (Hsp40) member C14) belongs to Hsp40 chaperone family. The protein contains 70-amino acid motif called J-domain and a C- terminal domain. J-domain facilitates ATP hydrolysis during chaperoning process. The gene coding for DNAJC14 protein is mapped to human chromosome 12q13.2.

Immunogen

DnaJ homolog subfamily C member 14 recombinant protein epitope signature tag (PrEST)

Application

Anti-DNAJC14 antibody produced in rabbit has been used for immunofluorescence studies and western blot analysis. All Prestige Antibodies^®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Biochem/physiol Actions

DNAJC14 (DnaJ heat shock protein family (Hsp40) member C14) chaperone protein interacts with dopamine D1 receptor and regulates receptor trafficking between endoplasmic reticulum (ER) and plasma membrane. It also modulates the life cycles of various Flaviviridae family members and Flavivirus replication. DNAJC14 helps in SNARE (Soluble N-ethylmaleimide-sensitive factor activating protein receptor) complex-mediated transport by interacting with the lysosomal trafficking regulator protein.
DNAJC14 plays an important role in regulating yellow fever virus (YFV) replication complex assembly. The DNAJC family protein are also involved in various biological processes such as translation, exocytosis and endocytosis.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST72886

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Compare Similar Items

View Full Comparison

Show Differences

1 of 1

This Item	HPA011947	HPA023015	HPA010642
Sigma-Aldrich HPA017653 Anti-DNAJC14 antibody produced in rabbit	Sigma-Aldrich HPA011947 Anti-DNAJC4 antibody produced in rabbit	Sigma-Aldrich HPA023015 Anti-DNAJC7 antibody produced in rabbit	Sigma-Aldrich HPA010642 Anti-DNAJB12 antibody produced in rabbit
Quality Level 100	Quality Level 100	Quality Level 100	Quality Level 100
biological source rabbit	biological source rabbit	biological source rabbit	biological source rabbit
antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody	antibody form affinity isolated antibody
conjugate unconjugated	conjugate unconjugated	conjugate unconjugated	conjugate unconjugated
product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies	product line Prestige Antibodies^® Powered by Atlas Antibodies
form buffered aqueous glycerol solution	form buffered aqueous glycerol solution	form buffered aqueous glycerol solution	form buffered aqueous glycerol solution

Still not finding the right product?

Try our Product Selector Tool to narrow your options

Storage Class

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

R07120

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Search for a COA

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Radiation hybrid mapping of equine CDK2, DGKA, DNAJC14, MMP19, CTSL and GAS1.

C Wittwer et al.

Animal genetics, 36(6), 536-537 (2005-11-19)

Chaperone-Assisted Protein Folding Is Critical for Yellow Fever Virus NS3/4A Cleavage and Replication.

Leonia Bozzacco et al.

Journal of virology, 90(6), 3212-3228 (2016-01-08)

DNAJC14, a heat shock protein 40 (Hsp40) cochaperone, assists with Hsp70-mediated protein folding. Overexpressed DNAJC14 is targeted to sites of yellow fever virus (YFV) replication complex (RC) formation, where it interacts with viral nonstructural (NS) proteins and inhibits viral RNA

Dopamine receptor-interacting protein 78 acts as a molecular chaperone for CCR5 chemokine receptor signaling complex organization.

Yi-Qun Kuang et al.

PloS one, 7(7), e40522-e40522 (2012-07-21)

Chemokine receptors are members of the G protein-coupled receptor (GPCR) family. CCR5 and CXCR4 act as co-receptors for human immunodeficiency virus (HIV) and several efforts have been made to develop ligands to inhibit HIV infection by blocking those receptors. Removal

View All Related Papers

Global Trade Item Number

SKU	GTIN
HPA017653-100UL	04061836323073
HPA017653-25UL	04061842836017

Questions

Reviews

No rating value