Skip to Content
MilliporeSigma
All Photos(1)

Key Documents

MSST0029

Sigma-Aldrich

SILuProt APOA2 Apolipoprotein A-II human

recombinant, expressed in HEK 293 cells, SIL MS Protein Standard, 13C and 15N-labeled

Synonym(s):

Apo-AII, ApoA-II, ApolipoproteinA2

Sign Into View Organizational & Contract Pricing

Select a Size

10 μG
$743.00

$743.00


Estimated to ship onMay 26, 2025



Select a Size

Change View
10 μG
$743.00

About This Item

UNSPSC Code:
23201100
NACRES:
NA.12

$743.00


Estimated to ship onMay 26, 2025


biological source

human

Quality Level

recombinant

expressed in HEK 293 cells

tag

8-His tagged

assay

≥98% (SDS-PAGE)

form

lyophilized powder

potency

≥98% Heavy amino acids incorporation efficiency by MS

technique(s)

mass spectrometry (MS): suitable

suitability

suitable for mass spectrometry (standard)

UniProt accession no.

storage temp.

−20°C

Gene Information

human ... APOA2(336)

Related Categories

General description

Apolipoprotein A-II (ApoA-II) occurs in plasma as a dimer of two 77-amino acid chains linked by a disulfide bridge. After apoA-I, it is the second major protein component of HDL, accounting for approximately 20% of HDL total protein. ApoA-II is thought to play an important role in triglyceride metabolism both from animal and human studies. 3 Recent findings attribute apoA-II to inhibitory effects on lipoprotein lipase-mediated hydrolysis of triglyceride-rich particles. Additional associations of apoA-II have been reported for a variety of protein factors including hepatic lipase (HL), lipoprotein lipase (LPL), endothelial lipase, CETP, PLTP, and LCAT.

Immunogen

QAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQDYKDDDDKGHHHHHHHHGGQ

Biochem/physiol Actions

SILu Prot APOA2 is a recombinant, stable isotope-labeled human APOA2 which incorporates [13C6, 15N4]-Arginine and [13C6, 15N4]-Lysine. Expressed in human 293 cells, it is designed to be used as an internal standard for bioanalysis of APOA2 in mass-spectrometry. SILu Prot APOA2 is a homodimer of 97 amino acids (including C-terminal polyhistidine and FLAG® tags), with a calculated molecular mass of 11 kDa.

Physical form

Supplied as a lyophilized powder containing phosphate buffered saline.

Legal Information

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), [email protected].
FLAG is a registered trademark of Merck KGaA, Darmstadt, Germany
SILu is a trademark of Sigma-Aldrich Co. LLC

Storage Class

11 - Combustible Solids

wgk_germany

WGK 2

flash_point_f

Not applicable

flash_point_c

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service