Przejdź do zawartości
Merck

WH0023404M6

Sigma-Aldrich

Monoclonal Anti-EXOSC2 antibody produced in mouse

clone 4B6, purified immunoglobulin, buffered aqueous solution

Synonim(y):

Anti-RRP4, Anti-Rrp4p, Anti-exosome component 2, Anti-hRrp4p, Anti-p7

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych


About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

mouse

białko sprzężone

unconjugated

forma przeciwciała

purified immunoglobulin

rodzaj przeciwciała

primary antibodies

klon

4B6, monoclonal

Postać

buffered aqueous solution

reaktywność gatunkowa

human

metody

indirect ELISA: suitable

izotyp

IgG2aκ

numer dostępu GenBank

numer dostępu UniProt

Warunki transportu

dry ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... EXOSC2(23404)

Opis ogólny

EXOSC2 (Exosome component 2) is a non-catalytic subunit of the eukaryotic RNA exosome. It is localized in the nucleus and in the cytoplasm.

Immunogen

EXOSC2 (NP_055100, 71 a.a. ~ 160 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
ALKTRYIGEVGDIVVGRITEVQQKRWKVETNSRLDSVLLLSSMNLPGGELRRRSAEDELAMRGFLQEGDLISAEVQAVFSDGAVSLHTRS

Działania biochem./fizjol.

EXOSC2 (Exosome component 2) is associated with several cellular processes such as rRNA processing, RNA degradation from the 3′ end, 3′ to 5′ decay of the mRNA body after its deadenylation. Exosome complex is an ~400kDa multimeric complex, which plays a vital role in substrate recognition. EXOSC2 functions as a cofactor in the maintenance of human exosome integrity and efficient degradation and/or metabolism of various RNA classes.

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4

Informacje prawne

GenBank is a registered trademark of United States Department of Health and Human Services
This page may contain text that has been machine translated.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable

Środki ochrony indywidualnej

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Daniel L Kiss et al.
RNA (New York, N.Y.), 16(4), 781-791 (2010-02-27)
The RNA processing exosome complex was originally defined as an evolutionarily conserved multisubunit complex of ribonucleases responsible for the processing and/or turnover of stable RNAs. The exosome complex is also involved in the surveillance of mRNAs in both the nucleus
Rafal Tomecki et al.
The EMBO journal, 29(14), 2342-2357 (2010-06-10)
The eukaryotic RNA exosome is a ribonucleolytic complex involved in RNA processing and turnover. It consists of a nine-subunit catalytically inert core that serves a structural function and participates in substrate recognition. Best defined in Saccharomyces cerevisiae, enzymatic activity comes

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej