WH0022932M2

Monoclonal Anti-POMZP3 antibody produced in mouse

clone 2E7, purified immunoglobulin, buffered aqueous solution

• Synonim(y): Anti-MGC8359, Anti-POM (POM121 homolog, rat) and ZP3 fusion, Anti-POM121, Anti-POMZP3
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: mouse
• białko sprzężone: unconjugated
• forma przeciwciała: purified immunoglobulin
• rodzaj przeciwciała: primary antibodies
• klon: 2E7, monoclonal
• Postać: buffered aqueous solution
• reaktywność gatunkowa: rat, mouse, human
• metody: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• izotyp: IgG1κ
• numer dostępu GenBank: NM_152992
• numer dostępu UniProt: Q6PJE2
• Warunki transportu: dry ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... POMZP3(22932)

Opis

Opis ogólny

This gene appears to have resulted from a fusion of DNA sequences derived from 2 distinct loci, specifically through the duplication of two internal exons from the POM121 gene and four 3′ exons from the ZP3 gene. The 5′ end of this gene is similar to the 5` coding region of the POM121 gene which encodes an integral nuclear pore membrane protein. However, the protein encoded by this gene lacks the nuclear pore localization motif. The 3′ end of this gene is similar to the last 4 exons of the zona pellucida glycoprotein 3 (ZP3) gene and the encoded protein retains one zona pellucida domain. Multiple protein isoforms are encoded by transcript variants of this gene. (provided by RefSeq)

Immunogen

POMZP3 (NP_694537, 64 a.a. ~ 116 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
DQIFLDGQENKRSCLVDGLTDASSAFKVPRPGPDTLQFTVDVFHFANDSRNM*

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4

Informacje prawne

GenBank is a registered trademark of United States Department of Health and Human Services

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable
• Środki ochrony indywidualnej: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)