WH0001785M1

Monoclonal Anti-DNM2 antibody produced in mouse

clone 6C9, purified immunoglobulin, buffered aqueous solution

• Synonim(y): Anti-DYN2, Anti-DYNII, Anti-dynamin 2
• Numer MDL: MFCD01633305
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: mouse
• białko sprzężone: unconjugated
• forma przeciwciała: purified immunoglobulin
• rodzaj przeciwciała: primary antibodies
• klon: 6C9, monoclonal
• Formularz: buffered aqueous solution
• reaktywność gatunkowa: human
• metody: indirect ELISA: suitable; western blot: 1-5 μg/mL
• izotyp: IgG1κ
• numer dostępu GenBank: BC054501
• numer dostępu UniProt: P50570
• Warunki transportu: dry ice
• temp. przechowywania: −20°C
• informacje o genach: human ... DNM2(1785)

Opis

Opis ogólny

Dynamins represent one of the subfamilies of GTP-binding proteins. These proteins share considerable sequence similarity over the N-terminal portion of the molecule, which contains the GTPase domain. Dynamins are associated with microtubules. They have been implicated in cell processes such as endocytosis and cell motility, and in alterations of the membrane that accompany certain activities such as bone resorption by osteoclasts. Dynamins bind many proteins that bind actin and other cytoskeletal proteins. Dynamins can also self-assemble, a process that stimulates GTPase activity. Four alternatively spliced transcripts encoding different proteins have been described. Additional alternatively spliced transcripts may exist, but their full-length nature has not been determined. (provided by RefSeq)

Immunogen

DNM2 (AAH54501, 611 a.a. ~ 710 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SWKASFLRAGVYPEKDQAENEDGAQENTFSMDPQLERQVETIRNLVDSYVAIINKSIRDLMPKTIMHLMINNTKAFIHHELLAYLYSSADQSSLMEESAD

Działania biochem./fizjol.

DNM2 (dynamin 2) is a GTPase which is required for clathrin-mediated endocytosis. It is important for clathrin-coated pit maturation and clathrin-coated vesicle formation. DNM2 participates in neuronal morphology, axonal growth, centrosome cohesion, actin- and microtubular organization. Mutations in it are associated with Charcot-Marie-Tooth disease, centronuclear myopathy ADCNM (autosomal dominant centronuclear myopathy) and lethal congenital contractures syndrome type 5 (LCCS5). It is upregulated in prostate cancer.

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4

Informacje prawne

GenBank is a registered trademark of United States Department of Health and Human Services

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 12 - Non Combustible Liquids
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable
• Środki ochrony indywidualnej: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)