SAB5702743

Anti-SKP1 Antibody, clone 10G5X5, Rabbit Monoclonal

• Synonim(y): EMC19, OCP-II, OCP2, SKP1A, TCEB1L, p19A
• Kod UNSPSC: 12352203
• NACRES: NA.46

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• Materiały: colorless
• klon: 10G5X5, monoclonal
• Formularz: liquid
• masa cząsteczkowa: 20 kDa
• reaktywność gatunkowa: rat, rat, human
• stężenie: 0.25 mg/mL
• metody: immunofluorescence: 1:50 - 1:200; western blot: 1:500 - 1:2000
• kolor: colorless
• izotyp: IgG
• sekwencja immunogenna: HHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK
• numer dostępu UniProt: P63208
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... SKP1(6500)

Opis

Opis ogólny

This gene encodes a component of SCF complexes, which are composed of this protein, cullin 1, a ring-box protein, and one member of the F-box family of proteins. This protein binds directly to the F-box motif found in F-box proteins. SCF complexes are involved in the regulated ubiquitination of specific protein substrates, which targets them for degradation by the proteosome. Specific F-box proteins recognize different target protein(s), and many specific SCF substrates have been identified including regulators of cell cycle progression and development. Studies have also characterized the protein as an RNA polymerase II elongation factor. Alternative splicing of this gene results in two transcript variants. A related pseudogene has been identified on chromosome 7. [provided by RefSeq, Jul 2008]

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 64-163 of human SKP1 (P63208).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Zastosowanie

WB, IF/ICC

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 1