SAB2108470

Anti-AHR

IgG fraction of antiserum

• Synonim(y): Anti-bHLHe76
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: IgG fraction of antiserum
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Formularz: buffered aqueous solution
• masa cząsteczkowa: 96 kDa
• reaktywność gatunkowa: human
• stężenie: 0.5-1 mg/mL
• metody: immunoblotting: suitable; immunohistochemistry: suitable
• nr dostępu: NM_001621
• numer dostępu UniProt: P35869
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• informacje o genach: human ... AHR(196)

Opis

Immunogen

Synthetic peptide directed towards the N terminal region of human AHR

Działania biochem./fizjol.

AHR is a ligand-activated transcription factor involved in the regulation of biological responses to planar aromatic hydrocarbons. This receptor has been shown to regulate xenobiotic-metabolizing enzymes such as cytochrome P450. Its ligands included a variety of aromatic hydrocarbons.

Sekwencja

Synthetic peptide located within the following region: RAKSFFDVALKSSPTERNGGQDNCRAANFREGLNLQEGEFLLQALNGFVL

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 3
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable