Przejdź do zawartości
Merck
Wszystkie zdjęcia(1)

Kluczowe dokumenty

SAB2108408

Sigma-Aldrich

Anti-SLC16A3 antibody produced in rabbit

affinity isolated antibody

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
Wszystkie zdjęcia(1)

About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

rabbit

Poziom jakości

100

białko sprzężone

unconjugated

forma przeciwciała

affinity isolated antibody

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Postać

buffered aqueous solution

masa cząsteczkowa

50kDa

reaktywność gatunkowa

human

stężenie

0.5 mg - 1 mg/mL

metody

immunoblotting: suitable

numer dostępu NCBI

NM_030696

numer dostępu UniProt

P57787

Warunki transportu

wet ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... SLC16A3(9123)

Opis ogólny

Solute carrier family 16 member 3 (SLC16A3) encodes monocarboxylate transporter 4 (MCT4). MCT4 is targeted by the chaperone CD147 to the basolateral plasma membrane. MCT4 is highly expressed in astrocytes, skeletal muscle fibres, chondrocytes, placenta. In human chromosome, the gene SLC16A3 is located on 17q25.3.

Immunogen

Synthetic peptide directed towards the N terminal of human SLC16A3

Działania biochem./fizjol.

Slc16a3 is a proton-linked monocarboxylate transporter. It catalyses the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate. MCT4 is upregulated in the hypoxic environment in glioblastoma, and is implicated in solid tumours like breast cancer and bladder cancer and leads to metastasis.

Sekwencja

Synthetic peptide located within the following region: KAVSVFFKELMHEFGIGYSDTAWISSILLAMLYGTGPLCSVCVNRFGCRP

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Ta strona może zawierać tekst przetłumaczony maszynowo.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 3

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable

Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

DNA methylation of the SLC16A3 promoter regulates expression of the human lactate transporter MCT4 in renal cancer with consequences for clinical outcome
Fisel P, et al.
Clinical Cancer Research, 19(18), 5170-5181 (2013)
Identifying differential expression genes and single nucleotide variations using RNA-seq in metastatic melanoma
Liu D, et al.
Genetics and molecular research : GMR, 13, 8153-8162 (2014)
Partial maternal heterodisomy of chromosome 17q25 in a case of severe mental retardation
Rio M, et al.
Human Genetics, 108(6), 511-515 (2001)
Genetic variations of the MCT4 (SLC16A3) gene in the Chinese and Indian populations of Singapore
Lean CB and Lee EJD
Drug Metabolism and Pharmacokinetics, 27(4), 456-464 (2012)
Butyric acid increases trans epithelial transport of ferulic acid through upregulation of the monocarboxylate transporters SLC16A1 (MCT1) and SLC16A3 (MCT4)
Ziegler K, et al.
Archives of Biochemistry and Biophysics, 599, 3-12 (2016)
Wyświetl wszystkie powiązane dokumenty

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej