SAB2104862

Anti-ATP2A1, (N-terminal) antibody produced in rabbit

affinity isolated antibody

• Synonim(y): Anti-ATP2A, Anti-SERCA1
• Numer MDL: MFCD01634165
• Kod UNSPSC: 12352203
• NACRES: NA.41
• klon: polyclonal
• application: IHC; WB
• reaktywność gatunkowa: guinea pig, mouse, rabbit, bovine, human, rat
• metody: immunohistochemistry: suitable; western blot: suitable

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: affinity isolated antibody
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Formularz: buffered aqueous solution
• masa cząsteczkowa: 109 kDa
• reaktywność gatunkowa: guinea pig, mouse, rabbit, bovine, human, rat
• stężenie: 0.5 mg - 1 mg/mL
• metody: immunohistochemistry: suitable; western blot: suitable
• numer dostępu NCBI: NM_004320
• numer dostępu UniProt: Q7Z675
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• informacje o genach: human ... ATP2A1(487)

Opis

Immunogen

Synthetic peptide directed towards the N terminal region of human ATP2A1

Działania biochem./fizjol.

This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to

Sekwencja

Synthetic peptide located within the following region: MEAAHAKTTEECLAYFGVSETTGLTPDQVKRNLEKYGLNELPAEEGKTLW

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 3
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable