Przejdź do zawartości
Merck
Wszystkie zdjęcia(1)

Key Documents

SAB2104114

Sigma-Aldrich

Anti-NRARP antibody produced in rabbit

affinity isolated antibody

Synonim(y):

Anti-MGC61598

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
Wszystkie zdjęcia(1)

About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

rabbit

Poziom jakości

100

białko sprzężone

unconjugated

forma przeciwciała

affinity isolated antibody

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Postać

buffered aqueous solution

masa cząsteczkowa

12 kDa

reaktywność gatunkowa

mouse, rat, dog, bovine, pig, human

stężenie

0.5 mg - 1 mg/mL

metody

western blot: suitable

numer dostępu NCBI

NM_001004354

numer dostępu UniProt

Q7Z6K4

Warunki transportu

wet ice

temp. przechowywania

−20°C

informacje o genach

human ... NRARP(441478)

Opis ogólny

NRARP (NOTCH-regulated ankyrin repeat protein) works as a negative feedback regulator in Notch (neurogenic locus notch homolog protein) signaling. On the other hand, expression of NRARP is controlled by Notch protein. The protein has two ankyrin repeats.

Immunogen

Synthetic peptide directed towards the middle region of human NRARP

Działania biochem./fizjol.

During development, NRARP (NOTCH-regulated ankyrin repeat protein) is involved in crosstalk between NOTCH (neurogenic locus notch homolog protein) and WNT (wingless-type mouse mammary tumor virus integration site) signaling. Presence of NRARP allows proper vessel density in angiogenesis. In breast cancer, NRARP might enhances the cell proliferation. It is upregulated in thyroid cancer tissues and is associated with cell growth and invasion. It is also overexpressed in hepatocellular carcinoma tumor tissues.

Sekwencja

Synthetic peptide located within the following region: QNMTNCEFNVNSFGPEGQTALHQSVIDGNLELVKLLVKFGADIRLANRDG

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
This page may contain text that has been machine translated.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 3

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable

Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Overexpression of NOTCH-regulated ankyrin repeat protein is associated with breast cancer cell proliferation.
Imaoka T, et al.
Anticancer Research, 34, 2165-2171 (2014)
Nrarp coordinates endothelial Notch and Wnt signaling to control vessel density in angiogenesis.
Phng LK, et al.
Developmental Cell, 16, 70-82 (2009)
Downregulation of Notch-regulated Ankyrin Repeat Protein Exerts Antitumor Activities against Growth of Thyroid Cancer.
Chu BF, et al.
Chinese Medical Journal (English Edition), 129, 1544-1552 (2016)
Pingping Zhu et al.
Nature communications, 6, 7122-7122 (2015-05-20)
Liver cancer stem cells (CSCs) harbour self-renewal and differentiation properties, accounting for chemotherapy resistance and recurrence. However, the molecular mechanisms to sustain liver CSCs remain largely unknown. In this study, based on analysis of several hepatocellular carcinoma (HCC) transcriptome datasets

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej